StarFunc result for job id Q8WZ74

User Input

>input (1663 residues)
MATDGASCEPDLSRAPEDAAGAAAEAAKKEFDVDTLSKSELRMLLSVMEGELEARDLVIE
ALRARRKEVFIQERYGRFNLNDPFLALQRDYEAGAGDKEKKPVCTNPLSILEAVMAHCKK
MQERMSAQLAAAESRQKKLEMEKLQLQALEQEHKKLAARLEEERGKNKQVVLMLVKECKQ
LSGKVIEEAQKLEDVMAKLEEEKKKTNELEEELSAEKRRSTEMEAQMEKQLSEFDTEREQ
LRAKLNREEAHTTDLKEEIDKMRKMIEQLKRGSDSKPSLSLPRKTKDRRLVSISVGTEGT
VTRSVACQTDLVTENADHMKKLPLTMPVKPSTGSPLVSANAKGSVCTSATMARPGIDRQA
SYGDLIGASVPAFPPPSANKIEENGPSTGSTPDPTSSTPPLPSNAAPPTAQTPGIAPQNS
QAPPMHSLHSPCANTSLHPGLNPRIQAARFRFQGNANDPDQNGNTTQSPPSRDVSPTSRD
NLVAKQLARNTVTQALSRFTSPQAGAPSRPGVPPTGDVGTHPPVGRTSLKTHGVARVDRG
NPPPIPPKKPGLSQTPSPPHPQLKVIIDSSRASNTGAKVDNKTVASTPSSLPQGNRVINE
ENLPKSSSPQLPPKPSIDLTVAPAGCAVSALATSQVGAWPAATPGLNQPACSDSSLVIPT
TIAFCSSINPVSASSCRPGASDSLLVTASGWSPSLTPLLMSGGPAPLAGRPTLLQQAAAQ
GNVTLLSMLLNEEGLDINYSCEDGHSALYSAAKNGHTDCVRLLLSAEAQVNAADKNGFTP
LCAAAAQGHFECVELLISYDANINHAADGGQTPLYLACKNGNKECIKLLLEAGTNRSVKT
TDGWTPVHAAVDTGNVDSLKLLMYHRIPAHGNSFNEEESESSVFDLDGGEESPEGISKPV
VPADLINHANREGWTAAHIAASKGFKNCLEILCRHGGLEPERRDKCNRTVHDVATDDCKH
LLENLNALKIPLRISVGEIEPSNYGSDDLECENTICALNIRKQTSWDDFSKAVSQALTNH
FQAISSDGWWSLEDVTCNNTTDSNIGLSARSIRSITLGNVPWSVGQSFAQSPWDFMRKNK
AEHITVLLSGPQEGCLSSVTYASMIPLQMMQNYLRLVEQYHNVIFHGPEGSLQDYIVHQL
ALCLKHRQMAAGFSCEIVRAEVDAGFSKEQLLDLFISSACLIPVKQSPSKKKIIIILENL
EKSSLSELLRDFLAPLENRSTESPCTFQKGNGLSECYYFHENCFLMGTIAKACLQGSDLL
VQQHFRWVQLRWDGEPMQGLLQRFLRRKVVNKFKGQAPSPCDPVCKIVDWALSVWRQLNS
CLARLGTPEALLGPKYFLSCPVVPGHAQVTVKWMSKLWNGVIAPRVQEAILSRASVKRQP
GFGQTTAKRHPSQGQQAVVKAALSILLNKAVLHGCPLPRAELDQHTADFKGGSFPLSIVS
SYNTCNKKKGESGAWRKVNTSPRRKSGRFSLPTWNKPDLSTEGMKNKTISQLNCNRNASL
SKQKSLENDLSLTLNLDQRLSLGSDDEADLVKELQSMCSSKSESDISKIADSRDDLRMFD
SSGNNPVLSATINNLRMPVSQKEVSPLSSHQTTECSNSKSKTELGVSRVKSFLPVPRSKV
TQCSQNTKRSSSSSNTRQIEINNNSKEVNWNLHKNEHLEKPNK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2IBD4	0.559	0.563	0.000	1649	0.848	0.855	Q2IBD4.pdb.gz	CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Cttnbp2 PE=1 SV=1
2	AFDB:Q8WZ74	1.000	1.000	0.000	1663	1.000	1.000	Q8WZ74.pdb.gz	CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens OX=9606 GN=CTTNBP2 PE=1 SV=1
3	AFDB:E9Q842	0.208	0.146	2.317E-20	2432	0.137	0.093	E9Q842.pdb.gz	E9Q842_MOUSE Neuron navigator 2 OS=Mus musculus OX=10090 GN=Nav2 PE=1 SV=1
4	AFDB:Q5TZ18	0.205	0.153	3.077E-20	2269	0.141	0.104	Q5TZ18.pdb.gz	NAV3_DANRE Neuron navigator 3 OS=Danio rerio OX=7955 GN=nav3 PE=1 SV=1
5	AFDB:Q8IVL1	0.207	0.142	2.461E-19	2488	0.148	0.099	Q8IVL1.pdb.gz	NAV2_HUMAN Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=3
6	AFDB:Q80TN7	0.204	0.149	3.591E-19	2359	0.140	0.099	Q80TN7.pdb.gz	NAV3_MOUSE Neuron navigator 3 OS=Mus musculus OX=10090 GN=Nav3 PE=1 SV=2
7	AFDB:Q8IVL0	0.211	0.152	1.185E-17	2385	0.132	0.092	Q8IVL0.pdb.gz	NAV3_HUMAN Neuron navigator 3 OS=Homo sapiens OX=9606 GN=NAV3 PE=1 SV=3
8	AFDB:Q9P2B4	0.075	0.183	4.300E-16	639	0.153	0.399	Q9P2B4.pdb.gz	CT2NL_HUMAN CTTNBP2 N-terminal-like protein OS=Homo sapiens OX=9606 GN=CTTNBP2NL PE=1 SV=2
9	AFDB:Q99LJ0	0.076	0.186	1.775E-15	638	0.148	0.386	Q99LJ0.pdb.gz	CT2NL_MOUSE CTTNBP2 N-terminal-like protein OS=Mus musculus OX=10090 GN=Cttnbp2nl PE=1 SV=1
10	AFDB:Q8NEY1	0.207	0.185	2.470E-15	1877	0.140	0.124	Q8NEY1.pdb.gz	NAV1_HUMAN Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2
11	PDB:8cs9A	0.118	0.235	4.678E-12	796	0.047	0.098	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:2dvwA	0.127	0.892	7.250E-11	229	0.035	0.258	2dvwA.pdb.gz
13	PDB:4oauC	0.113	0.247	1.619E-10	692	0.037	0.090	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:1wg0A	0.126	0.809	6.373E-10	243	0.033	0.226	1wg0A.pdb.gz
15	PDB:6v9hC	0.120	0.697	1.178E-9	270	0.032	0.200	6v9hC.pdb.gz
16	PDB:6jd6B	0.088	0.731	9.420E-9	192	0.028	0.240	6jd6B.pdb.gz
17	PDB:5vkqA	0.088	0.097	3.537E-8	1499	0.033	0.037	5vkqA.pdb.gz
18	PDB:1bd8A	0.089	0.869	4.076E-8	156	0.025	0.263	1bd8A.pdb.gz
19	PDB:6mwqA	0.091	0.301	4.076E-8	493	0.032	0.110	6mwqA.pdb.gz
20	PDB:6ut6D	0.135	0.673	5.162E-8	292	0.032	0.182	6ut6D.pdb.gz	Structural asymmetry governs the assembly and GTPase activity of McrBC restriction complexes

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B9EJA2	0.0	2821	1648	0.851	0.859	CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus OX=10090 GN=Cttnbp2 PE=1 SV=2
2	Q2IBD4	0.0	2806	1649	0.848	0.856	CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Cttnbp2 PE=1 SV=1
3	Q8WZ74	0.0	3432	1663	1.000	1.000	CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens OX=9606 GN=CTTNBP2 PE=1 SV=1
4	Q9P2B4	2.62e-95	324	639	0.150	0.391	CT2NL_HUMAN CTTNBP2 N-terminal-like protein OS=Homo sapiens OX=9606 GN=CTTNBP2NL PE=1 SV=2
5	Q99LJ0	1.99e-76	270	638	0.090	0.235	CT2NL_MOUSE CTTNBP2 N-terminal-like protein OS=Mus musculus OX=10090 GN=Cttnbp2nl PE=1 SV=1
6	Q5TZ18	7.02e-30	132	2269	0.049	0.036	NAV3_DANRE Neuron navigator 3 OS=Danio rerio OX=7955 GN=nav3 PE=1 SV=1
7	V9GXT3	9.26e-30	132	2371	0.057	0.040	V9GXT3_MOUSE Neuron navigator 2 OS=Mus musculus OX=10090 GN=Nav2 PE=1 SV=1
8	V9GX91	1.38e-29	131	2432	0.057	0.039	V9GX91_MOUSE Neuron navigator 2 OS=Mus musculus OX=10090 GN=Nav2 PE=1 SV=1
9	E9Q842	1.42e-29	131	2432	0.057	0.039	E9Q842_MOUSE Neuron navigator 2 OS=Mus musculus OX=10090 GN=Nav2 PE=1 SV=1
10	Q8IVL1	1.47e-29	131	2488	0.057	0.038	NAV2_HUMAN Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=3
11	Q80TN7	1.91e-29	131	2359	0.063	0.045	NAV3_MOUSE Neuron navigator 3 OS=Mus musculus OX=10090 GN=Nav3 PE=1 SV=2
12	A0A8I5ZQM9	2.22e-29	130	2366	0.057	0.040	A0A8I5ZQM9_RAT Neuron navigator 2 OS=Rattus norvegicus OX=10116 GN=Nav2 PE=1 SV=1
13	A0A8I6A8E6	2.49e-29	130	2319	0.057	0.041	A0A8I6A8E6_RAT Neuron navigator 2 OS=Rattus norvegicus OX=10116 GN=Nav2 PE=1 SV=1
14	A0A0G2K833	2.54e-29	130	2356	0.057	0.040	A0A0G2K833_RAT Neuron navigator 2 OS=Rattus norvegicus OX=10116 GN=Nav2 PE=1 SV=2
15	F1LR12	3.35e-29	130	2392	0.057	0.039	F1LR12_RAT Neuron navigator 2 OS=Rattus norvegicus OX=10116 GN=Nav2 PE=1 SV=3
16	Q8IVL0	4.30e-29	130	2385	0.065	0.045	NAV3_HUMAN Neuron navigator 3 OS=Homo sapiens OX=9606 GN=NAV3 PE=1 SV=3
17	Q8CH77	3.04e-26	120	1875	0.054	0.048	NAV1_MOUSE Neuron navigator 1 OS=Mus musculus OX=10090 GN=Nav1 PE=1 SV=2
18	Q8NEY1	8.96e-26	119	1877	0.054	0.048	NAV1_HUMAN Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2
19	Q9VIQ9	1.35e-25	118	2197	0.060	0.046	SICK_DROME Protein sickie OS=Drosophila melanogaster OX=7227 GN=sick PE=3 SV=3
20	Q8C8R3	1.64e-23	112	3898	0.044	0.019	ANK2_MOUSE Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	2.6e-19	80.0	Ankyrin repeat
2	PF12796 Ank_2	2.1e-34	129.2	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	1.3e-16	69.8	Ankyrin repeat
4	PF13637 Ank_4	2.2e-32	122.2	Ankyrin repeats (many copies)
5	PF13857 Ank_5	3.3e-18	76.8	Ankyrin repeats (many copies)
6	PF08462 Carmo_coat_C	5.9e+02	12.0	Carmovirus coat protein
7	PF09727 CortBP2	1.1e-39	147.8	Cortactin-binding protein-2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000160373

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263918	0.996	Striatin
2	9606.ENSP00000350071	0.996	Striatin-3
3	9606.ENSP00000377867	0.996	Serine/threonine-protein kinase 26
4	9606.ENSP00000315702	0.995	MOB-like protein phocein
5	9606.ENSP00000221138	0.994	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
6	9606.ENSP00000324804	0.994	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
7	9606.ENSP00000325748	0.994	Serine/threonine-protein kinase 25
8	9606.ENSP00000365730	0.994	Serine/threonine-protein kinase 24
9	9606.ENSP00000271277	0.992	CTTNBP2 N-terminal-like protein
10	9606.ENSP00000358810	0.960	Striatin-interacting protein 1
11	9606.ENSP00000418447	0.951	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
12	9606.ENSP00000249344	0.947	Striatin-interacting protein 2
13	9606.ENSP00000375777	0.947	Striatin-4
14	9606.ENSP00000311344	0.940	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
15	9606.ENSP00000365745	0.939	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
16	9606.ENSP00000376506	0.939	Programmed cell death protein 10
17	9606.ENSP00000317334	0.932	T-complex protein 1 subunit alpha
18	9606.ENSP00000286788	0.926	T-complex protein 1 subunit theta
19	9606.ENSP00000275603	0.922	T-complex protein 1 subunit zeta
20	9606.ENSP00000475615	0.922	Spliceosome-associated protein CWC15 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0065008	0.938	regulation of biological quality
GO:0009987	0.884	cellular process
GO:0032501	0.869	multicellular organismal process
GO:0048856	0.829	anatomical structure development
GO:0051128	0.670	regulation of cellular component organization
GO:0007275	0.652	multicellular organism development
GO:0048731	0.531	system development
GO:0007399	0.479	nervous system development
GO:0007417	0.461	central nervous system development
GO:0008152	0.405	metabolic process
GO:0048518	0.383	positive regulation of biological process
GO:0048522	0.366	positive regulation of cellular process
GO:0071704	0.349	organic substance metabolic process
GO:0050896	0.319	response to stimulus
GO:0060322	0.315	head development
GO:0007420	0.305	brain development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0012505	0.995	endomembrane system
GO:0043227	0.995	membrane-bounded organelle
GO:0005737	0.994	cytoplasm
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0043231	0.989	intracellular membrane-bounded organelle
GO:0030054	0.979	cell junction
GO:0031982	0.950	vesicle
GO:0045202	0.945	synapse
GO:0005829	0.941	cytosol
GO:0005856	0.860	cytoskeleton
GO:0098978	0.844	glutamatergic synapse
GO:0005634	0.717	nucleus
GO:0031410	0.539	cytoplasmic vesicle
GO:0015629	0.528	actin cytoskeleton
GO:0016020	0.516	membrane
GO:0099503	0.392	secretory vesicle
GO:0098793	0.360	presynapse
GO:0030133	0.327	transport vesicle
GO:0065010	0.318	extracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]