StarFunc result for job id Q8WZ75

User Input

>input (1007 residues)
MGSGGDSLLGGRGSLPLLLLLIMGGMAQDSPPQILVHPQDQLFQGPGPARMSCQASGQPP
PTIRWLLNGQPLSMVPPDPHHLLPDGTLLLLQPPARGHAHDGQALSTDLGVYTCEASNRL
GTAVSRGARLSVAVLREDFQIQPRDMVAVVGEQFTLECGPPWGHPEPTVSWWKDGKPLAL
QPGRHTVSGGSLLMARAEKSDEGTYMCVATNSAGHRESRAARVSIQEPQDYTEPVELLAV
RIQLENVTLLNPDPAEGPKPRPAVWLSWKVSGPAAPAQSYTALFRTQTAPGGQGAPWAEE
LLAGWQSAELGGLHWGQDYEFKVRPSSGRARGPDSNVLLLRLPEKVPSAPPQEVTLKPGN
GTVFVSWVPPPAENHNGIIRGYQVWSLGNTSLPPANWTVVGEQTQLEIATHMPGSYCVQV
AAVTGAGAGEPSRPVCLLLEQAMERATQEPSEHGPWTLEQLRATLKRPEVIATCGVALWL
LLLGTAVCIHRRRRARVHLGPGLYRYTSEDAILKHRMDHSDSQWLADTWRSTSGSRDLSS
SSSLSSRLGADARDPLDCRRSLLSWDSRSPGVPLLPDTSTFYGSLIAELPSSTPARPSPQ
VPAVRRLPPQLAQLSSPCSSSDSLCSRRGLSSPRLSLAPAEAWKAKKKQELQHANSSPLL
RGSHSLELRACELGNRGSKNLSQSPGAVPQALVAWRALGPKLLSSSNELVTRHLPPAPLF
PHETPPTQSQQTQPPVAPQAPSSILLPAAPIPILSPCSPPSPQASSLSGPSPASSRLSSS
SLSSLGEDQDSVLTPEEVALCLELSEGEETPRNSVSPMPRAPSPPTTYGYISVPTASEFT
DMGRTGGGVGPKGGVLLCPPRPCLTPTPSEGSLANGWGSASEDNAASARASLVSSSDGSF
LADAHFARALAVAVDSFGFGLEPREADCVFIDASSPPSPRDEIFLTPNLSLPLWEWRPDW
LEDMEVSHTQRLGRGMPPWPPDSQISSQRSQLHCRMPKAGASPVDYS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C310	0.273	0.272	0.000	1012	0.774	0.770	Q8C310.pdb.gz	ROBO4_MOUSE Roundabout homolog 4 OS=Mus musculus OX=10090 GN=Robo4 PE=1 SV=2
2	AFDB:Q8WZ75	1.000	1.000	0.000	1007	1.000	1.000	Q8WZ75.pdb.gz	ROBO4_HUMAN Roundabout homolog 4 OS=Homo sapiens OX=9606 GN=ROBO4 PE=1 SV=1
3	AFDB:F1RE66	0.192	0.172	1.870E-56	1134	0.326	0.289	F1RE66.pdb.gz	F1RE66_DANRE Roundabout homolog 4 isoform X1 OS=Danio rerio OX=7955 GN=robo4 PE=4 SV=1
4	AFDB:F1R2D2	0.182	0.110	1.032E-41	1687	0.301	0.180	F1R2D2.pdb.gz
5	AFDB:F1QBD4	0.179	0.132	1.132E-39	1387	0.231	0.168	F1QBD4.pdb.gz
6	AFDB:A8JUV7	0.167	0.154	1.998E-24	1105	0.163	0.148	A8JUV7.pdb.gz	A8JUV7_DROME Brother of ihog, isoform G OS=Drosophila melanogaster OX=7227 GN=boi PE=1 SV=3
7	AFDB:Q4ZHG4	0.171	0.103	1.151E-19	1894	0.172	0.091	Q4ZHG4.pdb.gz	FNDC1_HUMAN Fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FNDC1 PE=2 SV=4
8	AFDB:Q2Q0I9	0.168	0.103	3.571E-18	1779	0.167	0.094	Q2Q0I9.pdb.gz	FNDC1_RAT Fibronectin type III domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Fndc1 PE=1 SV=2
9	AFDB:Q90X22	0.098	0.078	8.791E-16	1276	0.134	0.106	Q90X22.pdb.gz
10	PDB:5oj2B	0.149	0.209	2.553E-14	692	0.081	0.118	5oj2B.pdb.gz
11	PDB:1e07A	0.131	0.189	4.985E-11	642	0.054	0.084	1e07A.pdb.gz
12	PDB:6dldD	0.139	0.426	8.261E-11	269	0.049	0.182	6dldD.pdb.gz
13	PDB:6pxvA	0.166	0.200	5.355E-10	823	0.049	0.060	6pxvA.pdb.gz
14	AFDB:E7F5U2	0.104	0.055	6.018E-10	2497	0.148	0.060	E7F5U2.pdb.gz
15	PDB:8dtlA	0.155	0.206	1.471E-9	741	0.054	0.073	8dtlA.pdb.gz
16	PDB:8eyyA	0.163	0.208	3.840E-9	775	0.049	0.063	8eyyA.pdb.gz
17	PDB:6dlfA	0.133	0.451	5.752E-9	236	0.044	0.186	6dlfA.pdb.gz
18	PDB:7q5zA	0.074	0.060	3.728E-8	1344	0.053	0.039	7q5zA.pdb.gz
19	PDB:3o3uN	0.129	0.206	7.189E-8	580	0.046	0.079	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
20	PDB:5c6wJ	0.079	0.302	7.189E-8	238	0.048	0.202	5c6wJ.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C310	0.0	1365	1012	0.756	0.752	ROBO4_MOUSE Roundabout homolog 4 OS=Mus musculus OX=10090 GN=Robo4 PE=1 SV=2
2	Q8WZ75	0.0	2001	1007	1.000	1.000	ROBO4_HUMAN Roundabout homolog 4 OS=Homo sapiens OX=9606 GN=ROBO4 PE=1 SV=1
3	F1RE66	1.22e-82	293	1134	0.292	0.259	F1RE66_DANRE Roundabout homolog 4 isoform X1 OS=Danio rerio OX=7955 GN=robo4 PE=4 SV=1
4	Q90Z42	4.79e-47	173	330	0.091	0.279	Q90Z42_CHICK Roundabout1 protein (Fragment) OS=Gallus gallus OX=9031 GN=ROBO1 PE=2 SV=1
5	O55005	4.17e-44	177	1651	0.092	0.056	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
6	Q2M1J3	1.59e-43	175	1607	0.092	0.058	Q2M1J3_HUMAN ROBO1 protein OS=Homo sapiens OX=9606 GN=ROBO1 PE=1 SV=1
7	O89026	1.64e-43	175	1612	0.091	0.057	ROBO1_MOUSE Roundabout homolog 1 OS=Mus musculus OX=10090 GN=Robo1 PE=1 SV=1
8	Q9Y6N7	1.64e-43	175	1651	0.091	0.056	ROBO1_HUMAN Roundabout homolog 1 OS=Homo sapiens OX=9606 GN=ROBO1 PE=1 SV=1
9	Q96MS0	2.23e-42	171	1386	0.149	0.108	ROBO3_HUMAN Roundabout homolog 3 OS=Homo sapiens OX=9606 GN=ROBO3 PE=1 SV=2
10	Q8UVD7	3.59e-42	171	1614	0.088	0.055	Q8UVD7_XENLA Roundabout guidance receptor 1 L homeolog precursor OS=Xenopus laevis OX=8355 GN=robo1.L PE=2 SV=1
11	Q90Z41	6.49e-42	159	333	0.083	0.252	Q90Z41_CHICK Roundabout2 protein (Fragment) OS=Gallus gallus OX=9031 GN=ROBO2 PE=2 SV=1
12	Q90Z70	1.38e-40	165	1513	0.084	0.056	Q90Z70_DANRE Robo2 OS=Danio rerio OX=7955 GN=sb:eu937 PE=2 SV=1
13	Q9Z2I4	5.76e-39	160	1366	0.138	0.102	ROBO3_MOUSE Roundabout homolog 3 OS=Mus musculus OX=10090 GN=Robo3 PE=1 SV=2
14	D3Z4M6	7.45e-39	159	1402	0.138	0.099	D3Z4M6_MOUSE Roundabout guidance receptor 3 OS=Mus musculus OX=10090 GN=Robo3 PE=1 SV=1
15	A0A8I6AKD6	9.68e-39	159	1381	0.082	0.060	A0A8I6AKD6_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=1
16	A0A8I6A1P7	9.90e-39	159	1377	0.082	0.060	A0A8I6A1P7_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=1
17	F1M950	1.09e-38	159	1533	0.082	0.054	F1M950_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=4
18	A0A1W2Q6F3	1.10e-38	159	1512	0.082	0.055	A0A1W2Q6F3_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
19	A0A0G2JZA1	1.14e-38	159	1472	0.082	0.056	A0A0G2JZA1_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=2
20	Q9HCK4	1.97e-38	158	1378	0.082	0.060	ROBO2_HUMAN Roundabout homolog 2 OS=Homo sapiens OX=9606 GN=ROBO2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06832 BiPBP_C	8.3	17.9	Penicillin-Binding Protein C-terminus Family
2	PF08205 C2-set_2	0.00021	32.6	CD80-like C2-set immunoglobulin domain
3	PF00041 fn3	5.7e-07	41.1	Fibronectin type III domain
4	PF07679 I-set	1.3e-20	84.5	Immunoglobulin I-set domain
5	PF00047 ig	5.3e-10	50.7	Immunoglobulin domain
6	PF13895 Ig_2	4.2e-11	54.3	Immunoglobulin domain
7	PF13927 Ig_3	1.7e-22	91.1	Immunoglobulin domain
8	PF17736 Ig_C17orf99	3.8e+02	12.5	C17orf99 Ig domain
9	PF07686 V-set	0.093	24.3	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000304945

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000332164	0.997	Slit homolog 3 protein
2	9606.ENSP00000422591	0.992	Slit homolog 2 protein
3	9606.ENSP00000267257	0.976	Paxillin
4	9606.ENSP00000420321	0.875	Roundabout homolog 1
5	9606.ENSP00000266058	0.838	Slit homolog 1 protein
6	9606.ENSP00000386884	0.790	C-X-C chemokine receptor type 4
7	9606.ENSP00000366522	0.739	Rho GTPase activating protein 39
8	9606.ENSP00000344115	0.688	Cadherin-5
9	9606.ENSP00000369375	0.682	Angiopoietin-1 receptor
10	9606.ENSP00000346839	0.659	Fibronectin type III domain containing
11	9606.ENSP00000353013	0.645	C-type lectin domain containing 14A
12	9606.ENSP00000442600	0.624	Dystroglycan
13	9606.ENSP00000479243	0.603	Endothelial cell-specific chemotaxis regulator
14	9606.ENSP00000380903	0.593	Roundabout homolog 3
15	9606.ENSP00000263923	0.590	Vascular endothelial growth factor receptor 2
16	9606.ENSP00000261405	0.580	Von Willebrand factor
17	9606.ENSP00000361554	0.578	Tyrosine-protein kinase receptor Tie-1
18	9606.ENSP00000334952	0.568	Adhesion G protein-coupled receptor A3
19	9606.ENSP00000417335	0.565	Roundabout homolog 2
20	9606.ENSP00000173229	0.558	Netrin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0032501	0.994	multicellular organismal process
GO:0050789	0.977	regulation of biological process
GO:0050794	0.964	regulation of cellular process
GO:0032502	0.925	developmental process
GO:0048856	0.924	anatomical structure development
GO:0007275	0.907	multicellular organism development
GO:0048731	0.884	system development
GO:0009653	0.873	anatomical structure morphogenesis
GO:0048519	0.764	negative regulation of biological process
GO:0030154	0.731	cell differentiation
GO:0048523	0.721	negative regulation of cellular process
GO:0050896	0.692	response to stimulus
GO:0048468	0.593	cell development
GO:0048518	0.502	positive regulation of biological process
GO:0040012	0.475	regulation of locomotion
GO:0016043	0.466	cellular component organization
GO:0051239	0.453	regulation of multicellular organismal process
GO:2000145	0.441	regulation of cell motility
GO:0048522	0.417	positive regulation of cellular process
GO:0048583	0.396	regulation of response to stimulus
GO:0030334	0.367	regulation of cell migration
GO:0072359	0.344	circulatory system development
GO:0023051	0.306	regulation of signaling
GO:0010646	0.306	regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0043227	0.996	membrane-bounded organelle
GO:0005886	0.988	plasma membrane
GO:0005576	0.985	extracellular region
GO:0031982	0.973	vesicle
GO:0005615	0.955	extracellular space
GO:0043230	0.951	extracellular organelle
GO:0065010	0.943	extracellular membrane-bounded organelle
GO:0070062	0.919	extracellular exosome
GO:0005622	0.803	intracellular anatomical structure
GO:0005737	0.670	cytoplasm
GO:0043231	0.638	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]