StarFunc result for job id Q8WZA1

User Input

>input (660 residues)
MDDWKPSPLIKPFGARKKRSWYLTWKYKLTNQRALRRFCQTGAVLFLLVTVIVNIKLILD
TRRAISEANEDPEPEQDYDEALGRLEPPRRRGSGPRRVLDVEVYSSRSKVYVAVDGTTVL
EDEAREQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVLFLNMVAPGRVLICTVKDE
GSFHLKDTAKALLRSLGSQAGPALGWRDTWAFVGRKGGPVFGEKHSKSPALSSWGDPVLL
KTDVPLSSAEEAECHWADTELNRRRRRFCSKVEGYGSVCSCKDPTPIEFSPDPLPDNKVL
NVPVAVIAGNRPNYLYRMLRSLLSAQGVSPQMITVFIDGYYEEPMDVVALFGLRGIQHTP
ISIKNARVSQHYKASLTATFNLFPEAKFAVVLEEDLDIAVDFFSFLSQSIHLLEEDDSLY
CISAWNDQGYEHTAEDPALLYRVETMPGLGWVLRRSLYKEELEPKWPTPEKLWDWDMWMR
MPEQRRGRECIIPDVSRSYHFGIVGLNMNGYFHEAYFKKHKFNTVPGVQLRNVDSLKKEA
YEVEVHRLLSEAEVLDHSKNPCEDSFLPDTEGHTYVAFIRMEKDDDFTTWTQLAKCLHIW
DLDVRGNHRGLWRLFRKKNHFLMVGVPASPYSVKKPPSVTPIFLEPPPKEEGAPGAPEQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WZA1	1.000	1.000	0.000	660	1.000	1.000	Q8WZA1.pdb.gz	PMGT1_HUMAN Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=POMGNT1 PE=1 SV=2
2	AFDB:G5EFK6	0.450	0.667	8.619E-28	437	0.174	0.263	G5EFK6.pdb.gz	G5EFK6_CAEEL Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=gly-14 PE=2 SV=1
3	AFDB:P27115	0.434	0.628	3.418E-26	447	0.171	0.253	P27115.pdb.gz	MGAT1_RABIT Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Oryctolagus cuniculus OX=9986 GN=MGAT1 PE=1 SV=1
4	AFDB:Q9XGM8	0.435	0.637	4.301E-26	444	0.145	0.216	Q9XGM8.pdb.gz	MGAT1_ARATH Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Arabidopsis thaliana OX=3702 GN=GNTI PE=1 SV=1
5	AFDB:Q60GL7	0.427	0.605	6.433E-26	458	0.142	0.205	Q60GL7.pdb.gz	Q60GL7_DROME Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Drosophila melanogaster OX=7227 GN=Mgat1 PE=2 SV=1
6	AFDB:Q11068	0.432	0.622	5.400E-25	449	0.144	0.212	Q11068.pdb.gz	MGAT1_CAEEL Putative alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=gly-13 PE=2 SV=2
7	AFDB:G5EBG7	0.427	0.596	5.086E-24	467	0.141	0.199	G5EBG7.pdb.gz	G5EBG7_CAEEL Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=gly-12 PE=1 SV=1
8	AFDB:Q92520	0.216	0.598	3.932E-13	227	0.074	0.216	Q92520.pdb.gz	FAM3C_HUMAN Protein FAM3C OS=Homo sapiens OX=9606 GN=FAM3C PE=1 SV=1
9	AFDB:P58499	0.222	0.600	5.552E-13	235	0.076	0.213	P58499.pdb.gz	FAM3B_HUMAN Protein FAM3B OS=Homo sapiens OX=9606 GN=FAM3B PE=1 SV=2
10	AFDB:Q9D309	0.211	0.570	1.754E-12	235	0.073	0.204	Q9D309.pdb.gz	FAM3B_MOUSE Protein FAM3B OS=Mus musculus OX=10090 GN=Fam3b PE=1 SV=1
11	PDB:2yopC	0.210	0.728	3.375E-11	181	0.061	0.221	2yopC.pdb.gz
12	PDB:5vcmB	0.253	0.446	1.680E-8	358	0.080	0.148	5vcmB.pdb.gz	HumanN-acetylglucosaminyltransferase II substrate recognition uses a modular architecture that includes a convergent exosite.
13	PDB:5vcsB	0.239	0.458	2.372E-8	323	0.074	0.152	5vcsB.pdb.gz	HumanN-acetylglucosaminyltransferase II substrate recognition uses a modular architecture that includes a convergent exosite.
14	PDB:6fxrA	0.202	0.191	3.961E-6	700	0.073	0.069	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
15	PDB:4d11C	0.235	0.342	2.355E-5	436	0.068	0.103	4d11C.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N- Acetylgalactosaminyltransferase 2.
16	PDB:4d0tA	0.240	0.309	7.877E-5	496	0.053	0.071	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
17	PDB:6r8uA	0.188	0.269	1.663E-4	425	0.058	0.089	6r8uA.pdb.gz	The allosteric control mechanism of bacterial glycogen biosynthesis disclosed by cryoEM
18	PDB:2gamC	0.223	0.357	1.762E-4	374	0.056	0.099	2gamC.pdb.gz	X-ray Crystal Structure of Leukocyte Type Core 2 beta1,6-N-Acetylglucosaminyltransferase: Evidence for a covergence of metal ion independent glycosyltransferase mechanism.
19	PDB:4hg6A	0.198	0.178	1.762E-4	747	0.047	0.041	4hg6A.pdb.gz	Crystallographic snapshot of cellulose synthesis and membrane translocation.
20	PDB:6iwqA	0.230	0.272	2.791E-4	546	0.055	0.066	6iwqA.pdb.gz	Structural basis of carbohydrate transfer activity of UDP-GalNAc: Polypeptide N-acetylgalactosaminyltransferase 7.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8WZA1	0.0	1368	660	1.000	1.000	PMGT1_HUMAN Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=POMGNT1 PE=1 SV=2
2	Q91X88	0.0	1351	660	0.985	0.985	PMGT1_MOUSE Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 OS=Mus musculus OX=10090 GN=Pomgnt1 PE=1 SV=1
3	P27808	1.75e-38	150	447	0.185	0.273	MGAT1_MOUSE Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=Mgat1 PE=1 SV=1
4	P70680	4.33e-37	146	447	0.161	0.237	P70680_CRIGR Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Cricetulus griseus OX=10029 PE=2 SV=1
5	G5EFK6	1.36e-31	130	437	0.162	0.245	G5EFK6_CAEEL Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=gly-14 PE=2 SV=1
6	P27115	4.36e-31	129	447	0.144	0.213	MGAT1_RABIT Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Oryctolagus cuniculus OX=9986 GN=MGAT1 PE=1 SV=1
7	Q9XGM8	5.87e-31	128	444	0.120	0.178	MGAT1_ARATH Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Arabidopsis thaliana OX=3702 GN=GNTI PE=1 SV=1
8	Q9NGK4	3.92e-30	126	456	0.100	0.145	Q9NGK4_DROME Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Drosophila melanogaster OX=7227 GN=Mgat1 PE=2 SV=1
9	Q60GL7	4.26e-30	126	458	0.100	0.144	Q60GL7_DROME Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Drosophila melanogaster OX=7227 GN=Mgat1 PE=2 SV=1
10	P26572	5.62e-30	125	445	0.173	0.256	MGAT1_HUMAN Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=MGAT1 PE=1 SV=2
11	G5EBG7	1.25e-26	115	467	0.121	0.171	G5EBG7_CAEEL Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=gly-12 PE=1 SV=1
12	Q11068	1.41e-25	112	449	0.089	0.131	MGAT1_CAEEL Putative alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=gly-13 PE=2 SV=2
13	Q8BI06	1.66e-11	70.1	1361	0.061	0.029	CEMIP_MOUSE Cell migration-inducing and hyaluronan-binding protein OS=Mus musculus OX=10090 GN=Cemip PE=1 SV=4
14	P58499	1.75e-11	67.0	235	0.047	0.132	FAM3B_HUMAN Protein FAM3B OS=Homo sapiens OX=9606 GN=FAM3B PE=1 SV=2
15	P97805	7.58e-11	64.7	223	0.055	0.161	FAM3D_MOUSE Protein FAM3D OS=Mus musculus OX=10090 GN=Fam3d PE=2 SV=2
16	Q8WUJ3	8.23e-11	67.8	1361	0.059	0.029	CEMIP_HUMAN Cell migration-inducing and hyaluronan-binding protein OS=Homo sapiens OX=9606 GN=CEMIP PE=1 SV=2
17	Q92520	1.09e-10	64.3	227	0.061	0.176	FAM3C_HUMAN Protein FAM3C OS=Homo sapiens OX=9606 GN=FAM3C PE=1 SV=1
18	Q9D309	8.91e-10	61.6	235	0.047	0.132	FAM3B_MOUSE Protein FAM3B OS=Mus musculus OX=10090 GN=Fam3b PE=1 SV=1
19	Q96BQ1	9.18e-10	61.6	224	0.044	0.129	FAM3D_HUMAN Protein FAM3D OS=Homo sapiens OX=9606 GN=FAM3D PE=1 SV=1
20	P98173	1.06e-06	52.4	230	0.036	0.104	FAM3A_HUMAN Protein FAM3A OS=Homo sapiens OX=9606 GN=FAM3A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03071 GNT-I	1.2e-43	161.1	GNT-I family
2	PF15711 ILEI	5.2e-21	86.2	Interleukin-like EMT inducer
3	PF05060 MGAT2	1.4e+02	12.9	N-acetylglucosaminyltransferase II (MGAT2)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9483.ENSCJAP00000039225

Rank	PPI partner	STRING score	Description
1	9483.ENSCJAP00000015474	0.987	protein-O-mannosyltransferase 1
2	9483.ENSCJAP00000030847	0.968	protein-O-mannosyltransferase 2
3	9483.ENSCJAP00000045195	0.966	Protein O-linked mannose N-acetylglucosaminyltransferase 2 (beta 1,4-)
4	9483.ENSCJAP00000009460	0.926	Beta-1,4-galactosyltransferase 3
5	9483.ENSCJAP00000017055	0.911	Uncharacterized protein
6	9483.ENSCJAP00000045422	0.911	UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1
7	9483.ENSCJAP00000031035	0.878	Fukutin
8	9483.ENSCJAP00000007268	0.873	Dystroglycan 1 (dystrophin-associated glycoprotein 1)
9	9483.ENSCJAP00000001677	0.795	LARGE xylosyl- and glucuronyltransferase 1
10	9483.ENSCJAP00000027467	0.730	Transmembrane protein 5
11	9483.ENSCJAP00000052226	0.686	protein-O-mannose kinase
12	9483.ENSCJAP00000020999	0.672	Agrin
13	9483.ENSCJAP00000021568	0.671	Fukutin related protein
14	9483.ENSCJAP00000033292	0.665	Hexosyltransferase
15	9483.ENSCJAP00000012108	0.662	Dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit
16	9483.ENSCJAP00000037638	0.660	Dolichol kinase
17	9483.ENSCJAP00000002692	0.659	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1
18	9483.ENSCJAP00000007829	0.652	GDP-mannose pyrophosphorylase B
19	9483.ENSCJAP00000001597	0.651	Isoprenoid synthase domain containing
20	9483.ENSCJAP00000021413	0.609	LARGE xylosyl- and glucuronyltransferase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140103	1.000	catalytic activity, acting on a glycoprotein
GO:0030145	1.000	manganese ion binding
GO:0008375	1.000	acetylglucosaminyltransferase activity
GO:0047223	0.945	beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0006493	0.984	protein O-linked glycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.998	Golgi apparatus
GO:0031090	0.995	organelle membrane
GO:0000139	0.992	Golgi membrane
GO:0071944	0.720	cell periphery
GO:0005886	0.474	plasma membrane
GO:0070013	0.379	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
EC:2.4.1.146	0.945	acetylglucosaminyltransferase.

[back to server]