StarFunc result for job id Q8WZA2

User Input

>input (1011 residues)
MVAAHAAHSSSSAEWIACLDKRPLERSSEDVDIIFTRLKEVKAFEKFHPNLLHQICLCGY
YENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIGTAFGESILDN
TPRHATIVTRESSELLRIEQKDFKALWEKYRQYMAGLLAPPYGVMETGSNNDRIPDKENT
PLIEPHVPLRPANTITKVPSEKILRAGKILRNAILSRAPHMIRDRKYHLKTYRQCCVGTE
LVDWMMQQTPCVHSRTQAVGMWQVLLEDGVLNHVDQEHHFQDKYLFYRFLDDEHEDAPLP
TEEEKKECDEELQDTMLLLSQMGPDAHMRMILRKPPGQRTVDDLEIIYEELLHIKALSHL
STTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDD
FGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKV
PAGNRASNQGNSQPQQKYTVMSGTPEKILEHFLETIRLEATLNEATDSVLNDFIMMHCVF
MPNTQLCPALVAHYHAQPSQGTEQEKMDYALNNKRRVIRLVLQWAAMYGDLLQEDDVSMA
FLEEFYVSVSDDARMIAALKEQLPELEKIVKQISEDAKAPQKKHKVLLQQFNTGDERAQK
RQPIRGSDEVLFKVYCMDHTYTTIRVPVATSVKEVISAVADKLGSGEGLIIVKMSSGGEK
VVLKPNDVSVFTTLTINGRLFACPREQFDSLTPLPEQEGPTVGTVGTFELMSSKDLAYQM
TIYDWELFNCVHELELIYHTFGRHNFKKTTANLDLFLRRFNEIQFWVVTEICLCSQLSKR
VQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLM
DPSRNHRAYRLTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFIDNLVNFEKMRMIANTART
VRYYRSQPFNPDAAQANKNHQDVRSYVRQLNVIDNQRTLSQMSHRLEPRRP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:2byvE	0.889	0.973	0.000	922	0.886	0.972	2byvE.pdb.gz
2	PDB:4f7zA	0.915	0.977	0.000	946	0.900	0.962	4f7zA.pdb.gz
3	AFDB:Q8WZA2	1.000	1.000	0.000	1011	1.000	1.000	Q8WZA2.pdb.gz	RPGF4_HUMAN Rap guanine nucleotide exchange factor 4 OS=Homo sapiens OX=9606 GN=RAPGEF4 PE=1 SV=1
4	AFDB:A1Z6P8	0.730	0.733	1.472E-90	1006	0.488	0.490	A1Z6P8.pdb.gz	A1Z6P8_DROME Exchange protein directly activated by cAMP, isoform E OS=Drosophila melanogaster OX=7227 GN=Epac PE=3 SV=3
5	AFDB:Q9Z1C8	0.665	0.722	5.677E-70	926	0.417	0.456	Q9Z1C8.pdb.gz	RPGF3_RAT Rap guanine nucleotide exchange factor 3 OS=Rattus norvegicus OX=10116 GN=Rapgef3 PE=2 SV=2
6	AFDB:A0A590UJR0	0.502	0.565	1.980E-46	883	0.327	0.375	A0A590UJR0.pdb.gz	A0A590UJR0_HUMAN Rap guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=RAPGEF5 PE=1 SV=1
7	AFDB:Q9UHV5	0.475	0.716	3.909E-38	662	0.209	0.319	Q9UHV5.pdb.gz	RPGFL_HUMAN Rap guanine nucleotide exchange factor-like 1 OS=Homo sapiens OX=9606 GN=RAPGEFL1 PE=1 SV=2
8	AFDB:G5EDB9	0.525	0.374	2.951E-37	1470	0.239	0.165	G5EDB9.pdb.gz	RPGF_CAEEL Rap guanine nucleotide exchange factor OS=Caenorhabditis elegans OX=6239 GN=pxf-1 PE=1 SV=1
9	AFDB:Q8TEU7	0.545	0.360	3.780E-37	1601	0.250	0.158	Q8TEU7.pdb.gz	RPGF6_HUMAN Rap guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=RAPGEF6 PE=1 SV=2
10	AFDB:Q9Y4G8	0.474	0.323	2.514E-31	1499	0.190	0.128	Q9Y4G8.pdb.gz	RPGF2_HUMAN Rap guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=RAPGEF2 PE=1 SV=1
11	AFDB:Q9VMF3	0.486	0.318	2.165E-29	1573	0.202	0.130	Q9VMF3.pdb.gz	Q9VMF3_DROME Dizzy isoform AII OS=Drosophila melanogaster OX=7227 GN=PDZ-GEF PE=1 SV=2
12	AFDB:A0A0S2Z5S1	0.310	0.685	8.143E-23	444	0.195	0.444	A0A0S2Z5S1.pdb.gz	A0A0S2Z5S1_HUMAN Rap guanine nucleotide exchange factor 5 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RAPGEF5 PE=2 SV=1
13	PDB:5dykA	0.109	0.133	2.046E-12	809	0.085	0.106	5dykA.pdb.gz
14	PDB:3j4qB	0.108	0.274	1.166E-10	382	0.059	0.157	3j4qB.pdb.gz
15	PDB:6byrB	0.107	0.346	1.505E-9	288	0.068	0.240	6byrB.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
16	PDB:4dinB	0.107	0.290	4.400E-9	345	0.068	0.200	4dinB.pdb.gz	Localization and quaternary structure of the PKA RI Beta holoenzyme
17	PDB:6wjfC	0.102	0.311	1.203E-6	295	0.060	0.207	6wjfC.pdb.gz
18	PDB:3dkwA	0.110	0.446	2.634E-6	227	0.024	0.106	3dkwA.pdb.gz
19	PDB:4ev0D	0.114	0.486	4.146E-6	214	0.046	0.220	4ev0D.pdb.gz	Crystal Structure of T. thermophilius Catabolite Activator Protein
20	PDB:4avaA	0.094	0.272	1.028E-5	327	0.047	0.147	4avaA.pdb.gz	Cyclic AMP Regulation of Protein Lysine Acetylation in Mycobacterium Tuberculosis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KF54	0.0	880	935	0.457	0.494	A0A0B4KF54_DROME Exchange protein directly activated by cAMP, isoform F OS=Drosophila melanogaster OX=7227 GN=Epac PE=3 SV=1
2	A0A590UJR0	0.0	623	883	0.343	0.393	A0A590UJR0_HUMAN Rap guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=RAPGEF5 PE=1 SV=1
3	A1Z6P8	0.0	959	1006	0.493	0.495	A1Z6P8_DROME Exchange protein directly activated by cAMP, isoform E OS=Drosophila melanogaster OX=7227 GN=Epac PE=3 SV=3
4	A8MQ07	0.0	574	730	0.318	0.441	A8MQ07_HUMAN Rap guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=RAPGEF5 PE=1 SV=3
5	O95398	0.0	828	923	0.425	0.466	RPGF3_HUMAN Rap guanine nucleotide exchange factor 3 OS=Homo sapiens OX=9606 GN=RAPGEF3 PE=1 SV=6
6	Q7K3Z6	0.0	820	861	0.418	0.491	Q7K3Z6_DROME Exchange protein directly activated by cAMP, isoform D OS=Drosophila melanogaster OX=7227 GN=Epac PE=2 SV=1
7	Q8VCC8	0.0	810	918	0.416	0.459	RPGF3_MOUSE Rap guanine nucleotide exchange factor 3 OS=Mus musculus OX=10090 GN=Rapgef3 PE=1 SV=2
8	Q8WZA2	0.0	2118	1011	1.000	1.000	RPGF4_HUMAN Rap guanine nucleotide exchange factor 4 OS=Homo sapiens OX=9606 GN=RAPGEF4 PE=1 SV=1
9	Q9EQZ6	0.0	2066	1011	0.973	0.973	RPGF4_MOUSE Rap guanine nucleotide exchange factor 4 OS=Mus musculus OX=10090 GN=Rapgef4 PE=1 SV=1
10	Q9Z1C7	0.0	872	436	0.413	0.959	RPGF4_RAT Rap guanine nucleotide exchange factor 4 (Fragment) OS=Rattus norvegicus OX=10116 GN=Rapgef4 PE=2 SV=1
11	Q9Z1C8	0.0	814	926	0.420	0.459	RPGF3_RAT Rap guanine nucleotide exchange factor 3 OS=Rattus norvegicus OX=10116 GN=Rapgef3 PE=2 SV=2
12	A0A0S2Z561	3.00e-158	481	580	0.242	0.422	A0A0S2Z561_HUMAN HCG38228, isoform CRA_b (Fragment) OS=Homo sapiens OX=9606 GN=RAPGEF5 PE=2 SV=1
13	Q92565	3.00e-158	481	580	0.242	0.422	RPGF5_HUMAN Rap guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=RAPGEF5 PE=1 SV=1
14	Q9UHV5	1.04e-129	409	662	0.212	0.323	RPGFL_HUMAN Rap guanine nucleotide exchange factor-like 1 OS=Homo sapiens OX=9606 GN=RAPGEFL1 PE=1 SV=2
15	A0A0S2Z5S1	1.07e-71	247	444	0.115	0.261	A0A0S2Z5S1_HUMAN Rap guanine nucleotide exchange factor 5 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RAPGEF5 PE=2 SV=1
16	G5ECB8	2.56e-44	177	1146	0.118	0.104	G5ECB8_CAEEL Rap guanine nucleotide exchange factor 2 OS=Caenorhabditis elegans OX=6239 GN=pxf-1 PE=1 SV=1
17	G5ECE2	2.75e-44	177	1188	0.118	0.100	G5ECE2_CAEEL Rap guanine nucleotide exchange factor 2 OS=Caenorhabditis elegans OX=6239 GN=pxf-1 PE=1 SV=1
18	G5EEE0	4.49e-44	176	1305	0.118	0.091	G5EEE0_CAEEL Rap guanine nucleotide exchange factor 2 OS=Caenorhabditis elegans OX=6239 GN=pxf-1 PE=1 SV=1
19	F1MSG6	5.11e-44	176	1486	0.088	0.060	RPGF2_BOVIN Rap guanine nucleotide exchange factor 2 OS=Bos taurus OX=9913 GN=RAPGEF2 PE=1 SV=2
20	A0A2R8Y661	6.52e-44	176	1559	0.088	0.057	A0A2R8Y661_HUMAN Rap guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=RAPGEF2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00027 cNMP_binding	3.3e-30	115.4	Cyclic nucleotide-binding domain
2	PF00610 DEP	2.3e-18	77.3	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
3	PF00617 RasGEF	4e-49	178.8	RasGEF domain
4	PF00618 RasGEF_N	2.3e-10	52.0	RasGEF N-terminal motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380271

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000303960	0.999	ATP-binding cassette sub-family C member 8
2	9606.ENSP00000250559	0.997	Ras-related protein Rap-1b
3	9606.ENSP00000262231	0.993	Regulating synaptic membrane exocytosis protein 2
4	9606.ENSP00000358723	0.986	Ras-related protein Rap-1A
5	9606.ENSP00000334319	0.979	Protein piccolo
6	9606.ENSP00000345708	0.939	ATP-sensitive inward rectifier potassium channel 11
7	9606.ENSP00000254976	0.931	Synaptosomal-associated protein 25
8	9606.ENSP00000355533	0.919	Ryanodine receptor 2
9	9606.ENSP00000343027	0.912	Guanine nucleotide-binding protein G(i) subunit alpha-1
10	9606.ENSP00000312999	0.910	Guanine nucleotide-binding protein G(i) subunit alpha-2
11	9606.ENSP00000358867	0.909	Guanine nucleotide-binding protein G(k) subunit alpha
12	9606.ENSP00000421922	0.902	Alpha-2-macroglobulin receptor-associated protein
13	9606.ENSP00000245304	0.891	Ras-related protein Rap-2a
14	9606.ENSP00000360141	0.889	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
15	9606.ENSP00000256196	0.873	Ras-related protein R-Ras2
16	9606.ENSP00000428417	0.866	Regulating synaptic membrane exocytosis protein 1
17	9606.ENSP00000246792	0.863	Ras-related protein R-Ras
18	9606.ENSP00000419361	0.863	Adenylate cyclase type 5
19	9606.ENSP00000311405	0.862	Adenylate cyclase type 6
20	9606.ENSP00000286355	0.860	Adenylate cyclase type 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0097159	0.920	organic cyclic compound binding
GO:0043167	0.919	ion binding
GO:0043168	0.906	anion binding
GO:0030552	0.896	cAMP binding
GO:0019899	0.847	enzyme binding
GO:0008047	0.825	enzyme activator activity
GO:0005096	0.822	GTPase activator activity
GO:0030674	0.328	protein-macromolecule adaptor activity
GO:0051020	0.305	GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0023052	0.995	signaling
GO:0007154	0.995	cell communication
GO:0050896	0.992	response to stimulus
GO:0007165	0.978	signal transduction
GO:0007186	0.850	G protein-coupled receptor signaling pathway
GO:0023051	0.835	regulation of signaling
GO:0010646	0.835	regulation of cell communication
GO:0051179	0.780	localization
GO:0048518	0.773	positive regulation of biological process
GO:0065008	0.771	regulation of biological quality
GO:0032879	0.759	regulation of localization
GO:0051234	0.750	establishment of localization
GO:0006810	0.727	transport
GO:0048522	0.712	positive regulation of cellular process
GO:0051049	0.693	regulation of transport
GO:0060341	0.668	regulation of cellular localization
GO:0032880	0.639	regulation of protein localization
GO:0007267	0.595	cell-cell signaling
GO:0051046	0.555	regulation of secretion
GO:1903530	0.496	regulation of secretion by cell
GO:0051641	0.488	cellular localization
GO:0023061	0.487	signal release
GO:0050708	0.462	regulation of protein secretion
GO:0002250	0.453	adaptive immune response
GO:0051050	0.452	positive regulation of transport
GO:0010817	0.447	regulation of hormone levels
GO:0048583	0.411	regulation of response to stimulus
GO:0015833	0.409	peptide transport
GO:0009914	0.408	hormone transport
GO:0046879	0.400	hormone secretion
GO:0008104	0.351	protein localization
GO:0051222	0.330	positive regulation of protein transport
GO:0042221	0.325	response to chemical
GO:0030073	0.319	insulin secretion
GO:1903532	0.314	positive regulation of secretion by cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	0.997	plasma membrane
GO:0005829	0.963	cytosol
GO:0043226	0.958	organelle
GO:0043227	0.891	membrane-bounded organelle
GO:0030054	0.824	cell junction
GO:0043229	0.715	intracellular organelle
GO:0045202	0.565	synapse
GO:0043231	0.484	intracellular membrane-bounded organelle
GO:0031982	0.309	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]