StarFunc result for job id Q92185

User Input

>input (356 residues)
MSPCGRARRQTSRGAMAVLAWKFPRTRLPMGASALCVVVLCWLYIFPVYRLPNEKEIVQG
VLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNS
TYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGS
KSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLS
DVGANQTVLFANPNFLRSIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVAIYGFWPFSV
NMHEQPISHHYYDNVLPFSGFHAMPEEFLQLWYLHKIGALRMQLDPCEDTSLQPTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G3V7T2	0.942	0.942	5.515E-69	356	0.910	0.910	G3V7T2.pdb.gz	G3V7T2_RAT ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 OS=Rattus norvegicus OX=10116 GN=St8sia1 PE=3 SV=3
2	AFDB:Q6ZXA0	0.917	0.910	2.476E-59	359	0.646	0.641	Q6ZXA0.pdb.gz	SIA8A_XENLA Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Xenopus laevis OX=8355 GN=st8sia1 PE=1 SV=1
3	AFDB:Q8K4T1	0.831	0.744	1.415E-41	398	0.393	0.352	Q8K4T1.pdb.gz	SIA8F_MOUSE Alpha-2,8-sialyltransferase 8F OS=Mus musculus OX=10090 GN=St8sia6 PE=1 SV=1
4	AFDB:P61647	0.834	0.747	2.159E-41	398	0.402	0.359	P61647.pdb.gz	SIA8F_HUMAN Alpha-2,8-sialyltransferase 8F OS=Homo sapiens OX=9606 GN=ST8SIA6 PE=2 SV=1
5	AFDB:O15466	0.818	0.775	3.662E-39	376	0.382	0.362	O15466.pdb.gz	SIA8E_HUMAN Alpha-2,8-sialyltransferase 8E OS=Homo sapiens OX=9606 GN=ST8SIA5 PE=1 SV=2
6	AFDB:F1R0F8	0.815	0.808	6.306E-39	359	0.351	0.348	F1R0F8.pdb.gz
7	AFDB:Q6ZXC8	0.813	0.770	3.221E-38	376	0.385	0.364	Q6ZXC8.pdb.gz	SIA8E_RAT Alpha-2,8-sialyltransferase 8E OS=Rattus norvegicus OX=10116 GN=St8sia5 PE=1 SV=2
8	AFDB:P70126	0.822	0.712	1.292E-37	412	0.365	0.316	P70126.pdb.gz	SIA8E_MOUSE Alpha-2,8-sialyltransferase 8E OS=Mus musculus OX=10090 GN=St8sia5 PE=1 SV=2
9	AFDB:Q6KC03	0.744	0.740	4.421E-32	358	0.281	0.279	Q6KC03.pdb.gz	Q6KC03_DANRE Alpha-2,8-sialyltransferase ST8Sia IV OS=Danio rerio OX=7955 GN=pst PE=2 SV=1
10	AFDB:O43173	0.766	0.720	1.571E-31	380	0.287	0.268	O43173.pdb.gz	SIA8C_HUMAN Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA3 PE=1 SV=3
11	PDB:6aplC	0.534	0.613	2.965E-11	306	0.169	0.196	6aplC.pdb.gz	Expression system for structural and functional studies of human glycosylation enzymes.
12	PDB:4qsmA	0.129	0.135	2.453E-2	332	0.067	0.072	4qsmA.pdb.gz	Structures of lactate dehydrogenase A (LDHA) in apo, ternary and inhibitor-bound forms.
13	PDB:1uufA	0.155	0.161	3.525E-2	339	0.062	0.065	1uufA.pdb.gz	Crystal Structure of a Yahk, a Zinc-Type Alcohol Dehydrogenase-Like Protein
14	PDB:5zueA	0.164	0.182	3.744E-2	309	0.065	0.074	5zueA.pdb.gz	Lateral interactions between protofilaments of the bacterial tubulin homolog FtsZ are essential for cell division
15	PDB:1isgA	0.171	0.220	3.977E-2	250	0.081	0.116	1isgA.pdb.gz	Crystallographic studies on human BST-1/CD157 with ADP-ribosyl cyclase and NAD glycohydrolase activities.
16	PDB:7mqaSI	0.174	0.092	3.977E-2	803	0.084	0.037	7mqaSI.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:1gsoA	0.110	0.099	5.380E-2	419	0.059	0.050	1gsoA.pdb.gz
18	PDB:6hcyC	0.120	0.104	5.380E-2	436	0.039	0.032	6hcyC.pdb.gz	Cryo-EM structures of human STEAP4 reveal mechanism of iron(III) reduction.
19	PDB:5z1zC	0.157	0.169	6.070E-2	316	0.084	0.095	5z1zC.pdb.gz
20	PDB:6rkeA	0.142	0.171	6.070E-2	272	0.065	0.085	6rkeA.pdb.gz	Molybdate pumping into the molybdenum storage protein via an ATP-powered piercing mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V7T2	0.0	679	356	0.910	0.910	G3V7T2_RAT ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 OS=Rattus norvegicus OX=10116 GN=St8sia1 PE=3 SV=3
2	Q64687	0.0	685	355	0.916	0.918	SIA8A_MOUSE Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia1 PE=1 SV=2
3	Q92185	0.0	750	356	1.000	1.000	SIA8A_HUMAN Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA1 PE=1 SV=1
4	Q6ZXA0	2.60e-175	493	359	0.624	0.618	SIA8A_XENLA Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Xenopus laevis OX=8355 GN=st8sia1 PE=1 SV=1
5	P61647	8.42e-92	282	398	0.402	0.359	SIA8F_HUMAN Alpha-2,8-sialyltransferase 8F OS=Homo sapiens OX=9606 GN=ST8SIA6 PE=2 SV=1
6	Q8K4T1	1.74e-91	281	398	0.368	0.329	SIA8F_MOUSE Alpha-2,8-sialyltransferase 8F OS=Mus musculus OX=10090 GN=St8sia6 PE=1 SV=1
7	O15466	8.88e-84	260	376	0.360	0.340	SIA8E_HUMAN Alpha-2,8-sialyltransferase 8E OS=Homo sapiens OX=9606 GN=ST8SIA5 PE=1 SV=2
8	Q6ZXC8	7.76e-81	253	376	0.348	0.330	SIA8E_RAT Alpha-2,8-sialyltransferase 8E OS=Rattus norvegicus OX=10116 GN=St8sia5 PE=1 SV=2
9	P70126	9.52e-80	251	412	0.348	0.301	SIA8E_MOUSE Alpha-2,8-sialyltransferase 8E OS=Mus musculus OX=10090 GN=St8sia5 PE=1 SV=2
10	Q07977	9.40e-53	180	375	0.292	0.277	SIA8B_RAT Alpha-2,8-sialyltransferase 8B OS=Rattus norvegicus OX=10116 GN=St8sia2 PE=2 SV=1
11	Q92186	3.25e-52	179	375	0.301	0.285	SIA8B_HUMAN Alpha-2,8-sialyltransferase 8B OS=Homo sapiens OX=9606 GN=ST8SIA2 PE=2 SV=1
12	O35696	6.08e-52	178	375	0.264	0.251	SIA8B_MOUSE Alpha-2,8-sialyltransferase 8B OS=Mus musculus OX=10090 GN=St8sia2 PE=1 SV=2
13	Q6KC03	5.04e-50	172	358	0.267	0.265	Q6KC03_DANRE Alpha-2,8-sialyltransferase ST8Sia IV OS=Danio rerio OX=7955 GN=pst PE=2 SV=1
14	Q8QH83	2.01e-49	172	381	0.278	0.260	Q8QH83_DANRE Alpha-2,8-sialyltransferase 8B OS=Danio rerio OX=7955 GN=siat8 PE=2 SV=1
15	B0CN48	5.81e-49	170	374	0.281	0.267	B0CN48_DANRE Alpha-2,8-sialyltransferase ST8Sia III OS=Danio rerio OX=7955 GN=siat 8C PE=2 SV=1
16	O43173	1.84e-48	169	380	0.278	0.261	SIA8C_HUMAN Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA3 PE=1 SV=3
17	Q64689	1.00e-47	167	380	0.278	0.261	SIA8C_MOUSE Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia3 PE=1 SV=2
18	Q64690	1.64e-47	166	359	0.264	0.262	SIA8D_CRIGR CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase OS=Cricetulus griseus OX=10029 GN=ST8SIA4 PE=1 SV=1
19	Q64692	2.76e-47	166	359	0.261	0.259	SIA8D_MOUSE CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia4 PE=2 SV=1
20	A1KQY6	4.45e-46	165	454	0.261	0.205	A1KQY6_RAT ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St8sia4 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00777 Glyco_transf_29	5.5e-69	244.3	Glycosyltransferase family 29 (sialyltransferase)
2	PF05136 Phage_portal_2	3e+02	12.0	Phage portal protein, lambda family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379353

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366549	0.987	Lactosylceramide alpha-2,3-sialyltransferase
2	9606.ENSP00000341562	0.980	Beta-1,4 N-acetylgalactosaminyltransferase 1
3	9606.ENSP00000480884	0.950	Type 2 lactosamine alpha-2,3-sialyltransferase
4	9606.ENSP00000428540	0.934	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1
5	9606.ENSP00000377257	0.930	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
6	9606.ENSP00000262915	0.925	ST3 beta-galactoside alpha-2,3-sialyltransferase 3
7	9606.ENSP00000305603	0.924	Galactoside 3(4)-L-fucosyltransferase
8	9606.ENSP00000268097	0.917	Beta-hexosaminidase subunit alpha
9	9606.ENSP00000313398	0.912	Alpha-(1,3)-fucosyltransferase 6
10	9606.ENSP00000321343	0.912	Alpha-2,8-sialyltransferase 8E
11	9606.ENSP00000261416	0.908	Beta-hexosaminidase subunit beta
12	9606.ENSP00000318142	0.903	Alpha-(1,3)-fucosyltransferase 7
13	9606.ENSP00000466880	0.902	Alpha-(1,3)-fucosyltransferase 5
14	9606.ENSP00000351602	0.901	Alpha-(1,3)-fucosyltransferase 4
15	9606.ENSP00000376587	0.900	Acetyl-coenzyme A transporter 1
16	9606.ENSP00000220822	0.764	Ganglioside-induced differentiation-associated protein 1
17	9606.ENSP00000210444	0.725	Sialic acid synthase
18	9606.ENSP00000297273	0.720	N-acetylneuraminate 9-O-acetyltransferase
19	9606.ENSP00000356951	0.719	Protein Flattop
20	9606.ENSP00000294064	0.704	Sialidase-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008373	1.000	sialyltransferase activity
GO:0005488	0.857	binding
GO:0005515	0.806	protein binding
GO:0003828	0.434	alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:0009058	0.993	biosynthetic process
GO:1901135	0.993	carbohydrate derivative metabolic process
GO:0044237	0.992	cellular metabolic process
GO:0006807	0.988	nitrogen compound metabolic process
GO:1901564	0.984	organonitrogen compound metabolic process
GO:0006643	0.975	membrane lipid metabolic process
GO:1901576	0.968	organic substance biosynthetic process
GO:1901137	0.964	carbohydrate derivative biosynthetic process
GO:0044249	0.957	cellular biosynthetic process
GO:1901566	0.941	organonitrogen compound biosynthetic process
GO:0006664	0.787	glycolipid metabolic process
GO:0006665	0.767	sphingolipid metabolic process
GO:0006687	0.759	glycosphingolipid metabolic process
GO:0046467	0.745	membrane lipid biosynthetic process
GO:0009247	0.740	glycolipid biosynthetic process
GO:0030148	0.734	sphingolipid biosynthetic process
GO:0005975	0.703	carbohydrate metabolic process
GO:0006688	0.665	glycosphingolipid biosynthetic process
GO:0009100	0.594	glycoprotein metabolic process
GO:0009101	0.526	glycoprotein biosynthetic process
GO:0043413	0.485	macromolecule glycosylation
GO:0006486	0.484	protein glycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.-.-	1.000	Glycosyltransferases.
RHEA:19313	0.434	an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->8)-N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl derivative + CMP + H(+)
EC:2.4.99.8	0.434	Transferred entry: 2.4.3.8.

[back to server]