StarFunc result for job id Q92186

User Input

>input (375 residues)
MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVIN
GSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPG
DIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFGTCAIVGNSGVLLNSGCGQEIDAHSF
VIRCNLAPVQEYARDVGLKTDLVTMNPSVIQRAFEDLVNATWREKLLQRLHSLNGSILWI
PAFMARGGKERVEWVNELILKHHVNVRTAYPSLRLLHAVRGYWLTNKVHIKRPTTGLLMY
TLATRFCKQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPHTMPLEFKALKSLHE
QGALKLTVGQCDGAT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35696	0.909	0.909	9.210E-73	375	0.979	0.979	O35696.pdb.gz	SIA8B_MOUSE Alpha-2,8-sialyltransferase 8B OS=Mus musculus OX=10090 GN=St8sia2 PE=1 SV=2
2	AFDB:Q1LVN2	0.863	0.850	1.762E-57	381	0.627	0.617	Q1LVN2.pdb.gz
3	AFDB:A1KQY6	0.768	0.636	3.793E-53	454	0.557	0.460	A1KQY6.pdb.gz	A1KQY6_RAT ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St8sia4 PE=3 SV=1
4	AFDB:Q6KC03	0.775	0.812	1.681E-50	358	0.531	0.556	Q6KC03.pdb.gz	Q6KC03_DANRE Alpha-2,8-sialyltransferase ST8Sia IV OS=Danio rerio OX=7955 GN=pst PE=2 SV=1
5	AFDB:O43173	0.755	0.745	6.409E-36	380	0.349	0.345	O43173.pdb.gz	SIA8C_HUMAN Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA3 PE=1 SV=3
6	AFDB:B0CN48	0.741	0.742	1.562E-33	374	0.325	0.326	B0CN48.pdb.gz	B0CN48_DANRE Alpha-2,8-sialyltransferase ST8Sia III OS=Danio rerio OX=7955 GN=siat 8C PE=2 SV=1
7	AFDB:G3V7T2	0.698	0.733	1.418E-30	356	0.269	0.284	G3V7T2.pdb.gz	G3V7T2_RAT ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 OS=Rattus norvegicus OX=10116 GN=St8sia1 PE=3 SV=3
8	AFDB:Q6ZXA0	0.699	0.729	5.602E-30	359	0.245	0.256	Q6ZXA0.pdb.gz	SIA8A_XENLA Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Xenopus laevis OX=8355 GN=st8sia1 PE=1 SV=1
9	AFDB:F1R0F8	0.718	0.749	1.902E-28	359	0.269	0.281	F1R0F8.pdb.gz
10	AFDB:P61647	0.703	0.665	1.902E-28	398	0.256	0.241	P61647.pdb.gz	SIA8F_HUMAN Alpha-2,8-sialyltransferase 8F OS=Homo sapiens OX=9606 GN=ST8SIA6 PE=2 SV=1
11	PDB:6aplC	0.517	0.617	3.108E-12	306	0.168	0.206	6aplC.pdb.gz	Expression system for structural and functional studies of human glycosylation enzymes.
12	PDB:5zfsB	0.203	0.240	1.994E-2	294	0.072	0.092	5zfsB.pdb.gz	X-ray structure of Arthrobacter globiformis M30 ketose 3-epimerase for the production of D-allulose from D-fructose.
13	PDB:4a2cA	0.133	0.138	3.848E-2	346	0.056	0.061	4a2cA.pdb.gz	The Crystal Structure of Galactitol-1-Phosphate 5-Dehydrogenase from Escherichia Coli K12 Provides Insights Into its Anomalous Behavior on Imac Processes
14	PDB:3jyoA	0.170	0.208	4.336E-2	282	0.064	0.085	3jyoA.pdb.gz	Enzyme-substrate complexes of the quinate/shikimate dehydrogenase from Corynebacterium glutamicum enable new insights in substrate and cofactor binding, specificity, and discrimination.
15	PDB:3ckyA	0.168	0.200	4.886E-2	297	0.040	0.051	3ckyA.pdb.gz
16	PDB:1dxhA	0.149	0.161	6.587E-2	335	0.085	0.096	1dxhA.pdb.gz
17	PDB:2b5wA	0.143	0.149	7.880E-2	357	0.051	0.053	2b5wA.pdb.gz	Analysis of protein solvent interactions in glucose dehydrogenase from the extreme halophile Haloferax mediterranei.
18	PDB:3tlxB	0.161	0.215	8.881E-2	240	0.061	0.096	3tlxB.pdb.gz	Crystal Structure of PF10_0086, adenylate kinase from plasmodium falciparum
19	PDB:3dojA	0.161	0.191	9.427E-2	292	0.045	0.058	3dojA.pdb.gz
20	PDB:1z7eD	0.126	0.086	1.001E-1	644	0.064	0.037	1z7eD.pdb.gz	Structure and Mechanism of ArnA: Conformational Change Implies Ordered Dehydrogenase Mechanism in Key Enzyme for Polymyxin Resistance

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35696	0.0	765	375	0.979	0.979	SIA8B_MOUSE Alpha-2,8-sialyltransferase 8B OS=Mus musculus OX=10090 GN=St8sia2 PE=1 SV=2
2	Q07977	0.0	763	375	0.976	0.976	SIA8B_RAT Alpha-2,8-sialyltransferase 8B OS=Rattus norvegicus OX=10116 GN=St8sia2 PE=2 SV=1
3	Q92186	0.0	782	375	1.000	1.000	SIA8B_HUMAN Alpha-2,8-sialyltransferase 8B OS=Homo sapiens OX=9606 GN=ST8SIA2 PE=2 SV=1
4	Q8QH83	8.62e-173	488	381	0.635	0.625	Q8QH83_DANRE Alpha-2,8-sialyltransferase 8B OS=Danio rerio OX=7955 GN=siat8 PE=2 SV=1
5	Q64692	6.42e-155	442	359	0.565	0.591	SIA8D_MOUSE CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia4 PE=2 SV=1
6	Q92187	3.57e-154	440	359	0.563	0.588	SIA8D_HUMAN CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA4 PE=1 SV=1
7	Q64690	5.90e-154	439	359	0.563	0.588	SIA8D_CRIGR CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase OS=Cricetulus griseus OX=10029 GN=ST8SIA4 PE=1 SV=1
8	A1KQY6	2.24e-152	439	454	0.560	0.463	A1KQY6_RAT ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St8sia4 PE=3 SV=1
9	Q6KC03	1.46e-144	416	358	0.504	0.528	Q6KC03_DANRE Alpha-2,8-sialyltransferase ST8Sia IV OS=Danio rerio OX=7955 GN=pst PE=2 SV=1
10	O43173	5.65e-76	241	380	0.323	0.318	SIA8C_HUMAN Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA3 PE=1 SV=3
11	Q64689	2.44e-74	237	380	0.312	0.308	SIA8C_MOUSE Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia3 PE=1 SV=2
12	B0CN48	2.44e-72	232	374	0.304	0.305	B0CN48_DANRE Alpha-2,8-sialyltransferase ST8Sia III OS=Danio rerio OX=7955 GN=siat 8C PE=2 SV=1
13	Q64687	1.49e-52	180	355	0.299	0.315	SIA8A_MOUSE Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia1 PE=1 SV=2
14	G3V7T2	3.21e-52	179	356	0.293	0.309	G3V7T2_RAT ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 OS=Rattus norvegicus OX=10116 GN=St8sia1 PE=3 SV=3
15	Q92185	3.42e-52	179	356	0.285	0.301	SIA8A_HUMAN Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA1 PE=1 SV=1
16	Q6ZXA0	5.11e-48	168	359	0.253	0.265	SIA8A_XENLA Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Xenopus laevis OX=8355 GN=st8sia1 PE=1 SV=1
17	O15466	5.37e-46	163	376	0.240	0.239	SIA8E_HUMAN Alpha-2,8-sialyltransferase 8E OS=Homo sapiens OX=9606 GN=ST8SIA5 PE=1 SV=2
18	Q8K4T1	3.73e-45	161	398	0.235	0.221	SIA8F_MOUSE Alpha-2,8-sialyltransferase 8F OS=Mus musculus OX=10090 GN=St8sia6 PE=1 SV=1
19	Q6ZXC8	2.46e-43	156	376	0.216	0.215	SIA8E_RAT Alpha-2,8-sialyltransferase 8E OS=Rattus norvegicus OX=10116 GN=St8sia5 PE=1 SV=2
20	P70126	4.59e-43	156	412	0.216	0.197	SIA8E_MOUSE Alpha-2,8-sialyltransferase 8E OS=Mus musculus OX=10090 GN=St8sia5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00777 Glyco_transf_29	3.5e-71	251.5	Glycosyltransferase family 29 (sialyltransferase)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000268164

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000480132	0.978	Neural cell adhesion molecule 1
2	9606.ENSP00000376178	0.928	Syntaxin-2
3	9606.ENSP00000222812	0.924	Syntaxin-1A
4	9606.ENSP00000414398	0.922	DnaJ homolog subfamily B member 11
5	9606.ENSP00000369055	0.920	Beta-1,4-galactosyltransferase 1
6	9606.ENSP00000310696	0.914	Beta-1,4-galactosyltransferase 2
7	9606.ENSP00000312021	0.914	Galactoside 2-alpha-L-fucosyltransferase 1
8	9606.ENSP00000302599	0.910	Alpha-(1,3)-fucosyltransferase 9
9	9606.ENSP00000420161	0.908	Beta-1,4-galactosyltransferase 4
10	9606.ENSP00000313398	0.907	Alpha-(1,3)-fucosyltransferase 6
11	9606.ENSP00000305603	0.904	Galactoside 3(4)-L-fucosyltransferase
12	9606.ENSP00000480428	0.903	Beta-1,4-galactosyltransferase 3
13	9606.ENSP00000466880	0.902	Alpha-(1,3)-fucosyltransferase 5
14	9606.ENSP00000417354	0.831	Golgi integral membrane protein 4
15	9606.ENSP00000256509	0.782	Neural cell adhesion molecule L1-like protein
16	9606.ENSP00000215095	0.719	Syntaxin-1B
17	9606.ENSP00000353582	0.706	Neuropilin-2
18	9606.ENSP00000297273	0.696	N-acetylneuraminate 9-O-acetyltransferase
19	9606.ENSP00000384906	0.679	Serum amyloid A-1 protein
20	9606.ENSP00000296499	0.662	Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008373	1.000	sialyltransferase activity
GO:0005488	0.979	binding
GO:0005515	0.954	protein binding
GO:0003828	0.330	alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0071704	0.990	organic substance metabolic process
GO:0044238	0.989	primary metabolic process
GO:0044237	0.983	cellular metabolic process
GO:1901137	0.982	carbohydrate derivative biosynthetic process
GO:1901564	0.979	organonitrogen compound metabolic process
GO:1901566	0.973	organonitrogen compound biosynthetic process
GO:0044249	0.967	cellular biosynthetic process
GO:0032501	0.960	multicellular organismal process
GO:0006643	0.937	membrane lipid metabolic process
GO:0032502	0.930	developmental process
GO:0043170	0.929	macromolecule metabolic process
GO:0009311	0.929	oligosaccharide metabolic process
GO:0070085	0.917	glycosylation
GO:0006665	0.912	sphingolipid metabolic process
GO:0048856	0.908	anatomical structure development
GO:0019538	0.897	protein metabolic process
GO:0007275	0.864	multicellular organism development
GO:0009100	0.843	glycoprotein metabolic process
GO:0030148	0.831	sphingolipid biosynthetic process
GO:0048731	0.814	system development
GO:0043412	0.749	macromolecule modification
GO:0006664	0.742	glycolipid metabolic process
GO:0065007	0.671	biological regulation
GO:0007399	0.654	nervous system development
GO:0009059	0.631	macromolecule biosynthetic process
GO:0043603	0.613	amide metabolic process
GO:0050794	0.598	regulation of cellular process
GO:0034645	0.586	cellular macromolecule biosynthetic process
GO:0006687	0.582	glycosphingolipid metabolic process
GO:0036211	0.579	protein modification process
GO:0009247	0.564	glycolipid biosynthetic process
GO:0006688	0.547	glycosphingolipid biosynthetic process
GO:0006491	0.520	N-glycan processing
GO:0009101	0.515	glycoprotein biosynthetic process
GO:0006672	0.416	ceramide metabolic process
GO:0006486	0.342	protein glycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005886	0.987	plasma membrane
GO:0098588	0.978	bounding membrane of organelle
GO:0005794	0.922	Golgi apparatus
GO:0031982	0.867	vesicle
GO:0000139	0.837	Golgi membrane
GO:0031410	0.512	cytoplasmic vesicle
GO:0048471	0.359	perinuclear region of cytoplasm
GO:0005768	0.340	endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.-.-	1.000	Glycosyltransferases.
RHEA:19313	0.330	an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl derivative + CMP-N-acetyl-beta-neuraminate = an N-acetyl-alpha-neuraminyl-(2->8)-N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl derivative + CMP + H(+)
EC:2.4.99.8	0.330	Transferred entry: 2.4.3.8.

[back to server]