StarFunc result for job id Q92187

User Input

>input (359 residues)
MRSIRKRWTICTISLLLIFYKTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAG
SSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNI
SHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIRCNLAPVVEFAAD
VGTKSDFITMNPSVVQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFMVKGGEKHVEWV
NALILKNKLKVRTAYPSLRLIHAVRGYWLTNKVPIKRPSTGLLMYTLATRFCDEIHLYGF
WPFPKDLNGKAVKYHYYDDLKYRYFSNASPHRMPLEFKTLNVLHNRGALKLTTGKCVKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1KQY6	0.836	0.662	1.875E-66	454	0.978	0.773	A1KQY6.pdb.gz	A1KQY6_RAT ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St8sia4 PE=3 SV=1
2	AFDB:Q6KC03	0.858	0.860	5.328E-56	358	0.680	0.682	Q6KC03.pdb.gz	Q6KC03_DANRE Alpha-2,8-sialyltransferase ST8Sia IV OS=Danio rerio OX=7955 GN=pst PE=2 SV=1
3	AFDB:O35696	0.825	0.790	5.145E-52	375	0.588	0.563	O35696.pdb.gz	SIA8B_MOUSE Alpha-2,8-sialyltransferase 8B OS=Mus musculus OX=10090 GN=St8sia2 PE=1 SV=2
4	AFDB:Q1LVN2	0.835	0.787	6.930E-52	381	0.571	0.538	Q1LVN2.pdb.gz
5	AFDB:O43173	0.780	0.738	4.053E-35	380	0.337	0.318	O43173.pdb.gz	SIA8C_HUMAN Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA3 PE=1 SV=3
6	AFDB:B0CN48	0.778	0.748	1.535E-33	374	0.345	0.332	B0CN48.pdb.gz	B0CN48_DANRE Alpha-2,8-sialyltransferase ST8Sia III OS=Danio rerio OX=7955 GN=siat 8C PE=2 SV=1
7	AFDB:Q6ZXA0	0.746	0.746	2.795E-30	359	0.281	0.281	Q6ZXA0.pdb.gz	SIA8A_XENLA Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Xenopus laevis OX=8355 GN=st8sia1 PE=1 SV=1
8	AFDB:P61647	0.764	0.693	3.342E-30	398	0.253	0.229	P61647.pdb.gz	SIA8F_HUMAN Alpha-2,8-sialyltransferase 8F OS=Homo sapiens OX=9606 GN=ST8SIA6 PE=2 SV=1
9	AFDB:O15466	0.734	0.703	4.778E-30	376	0.292	0.279	O15466.pdb.gz	SIA8E_HUMAN Alpha-2,8-sialyltransferase 8E OS=Homo sapiens OX=9606 GN=ST8SIA5 PE=1 SV=2
10	AFDB:Q8K4T1	0.738	0.668	1.482E-29	398	0.240	0.216	Q8K4T1.pdb.gz	SIA8F_MOUSE Alpha-2,8-sialyltransferase 8F OS=Mus musculus OX=10090 GN=St8sia6 PE=1 SV=1
11	PDB:6aplC	0.529	0.609	9.321E-12	306	0.187	0.219	6aplC.pdb.gz	Expression system for structural and functional studies of human glycosylation enzymes.
12	PDB:4a2cA	0.141	0.144	1.610E-2	346	0.067	0.069	4a2cA.pdb.gz	The Crystal Structure of Galactitol-1-Phosphate 5-Dehydrogenase from Escherichia Coli K12 Provides Insights Into its Anomalous Behavior on Imac Processes
13	PDB:3ckyA	0.175	0.200	2.169E-2	297	0.061	0.074	3ckyA.pdb.gz
14	PDB:1z7eD	0.160	0.107	2.922E-2	644	0.078	0.043	1z7eD.pdb.gz	Structure and Mechanism of ArnA: Conformational Change Implies Ordered Dehydrogenase Mechanism in Key Enzyme for Polymyxin Resistance
15	PDB:3oa2B	0.141	0.155	3.291E-2	311	0.056	0.064	3oa2B.pdb.gz	Structural and Functional Studies of WlbA: A Dehydrogenase Involved in the Biosynthesis of 2,3-Diacetamido-2,3-dideoxy-d-mannuronic Acid .
16	PDB:6f2cA	0.152	0.332	3.936E-2	124	0.022	0.065	6f2cA.pdb.gz
17	PDB:3jyoA	0.176	0.210	4.995E-2	282	0.078	0.099	3jyoA.pdb.gz	Enzyme-substrate complexes of the quinate/shikimate dehydrogenase from Corynebacterium glutamicum enable new insights in substrate and cofactor binding, specificity, and discrimination.
18	PDB:4eueA	0.202	0.189	8.045E-2	398	0.109	0.098	4eueA.pdb.gz	Structures of trans-2-enoyl-CoA reductases from Clostridium acetobutylicum and Treponema denticola: insights into the substrate specificity and the catalytic mechanism
19	PDB:1bxrA	0.124	0.064	9.063E-2	1073	0.042	0.014	1bxrA.pdb.gz	Carbamoyl phosphate synthetase: closure of the B-domain as a result of nucleotide binding.
20	PDB:5hmqD	0.183	0.123	9.063E-2	624	0.058	0.034	5hmqD.pdb.gz	Structure of a putative xylose isomerase-like TIM barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein from Pseudomonas putida at 2.4 Angstroms resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1KQY6	0.0	730	454	0.978	0.773	A1KQY6_RAT ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4 OS=Rattus norvegicus OX=10116 GN=St8sia4 PE=3 SV=1
2	Q64690	0.0	730	359	0.978	0.978	SIA8D_CRIGR CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase OS=Cricetulus griseus OX=10029 GN=ST8SIA4 PE=1 SV=1
3	Q64692	0.0	730	359	0.978	0.978	SIA8D_MOUSE CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia4 PE=2 SV=1
4	Q6KC03	0.0	515	358	0.691	0.693	Q6KC03_DANRE Alpha-2,8-sialyltransferase ST8Sia IV OS=Danio rerio OX=7955 GN=pst PE=2 SV=1
5	Q92187	0.0	743	359	1.000	1.000	SIA8D_HUMAN CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA4 PE=1 SV=1
6	O35696	8.71e-155	441	375	0.585	0.560	SIA8B_MOUSE Alpha-2,8-sialyltransferase 8B OS=Mus musculus OX=10090 GN=St8sia2 PE=1 SV=2
7	Q07977	1.04e-154	441	375	0.591	0.565	SIA8B_RAT Alpha-2,8-sialyltransferase 8B OS=Rattus norvegicus OX=10116 GN=St8sia2 PE=2 SV=1
8	Q92186	3.42e-154	440	375	0.588	0.563	SIA8B_HUMAN Alpha-2,8-sialyltransferase 8B OS=Homo sapiens OX=9606 GN=ST8SIA2 PE=2 SV=1
9	Q8QH83	1.65e-148	426	381	0.563	0.530	Q8QH83_DANRE Alpha-2,8-sialyltransferase 8B OS=Danio rerio OX=7955 GN=siat8 PE=2 SV=1
10	Q64689	1.48e-70	227	380	0.329	0.311	SIA8C_MOUSE Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia3 PE=1 SV=2
11	B0CN48	1.77e-70	226	374	0.320	0.307	B0CN48_DANRE Alpha-2,8-sialyltransferase ST8Sia III OS=Danio rerio OX=7955 GN=siat 8C PE=2 SV=1
12	O43173	8.71e-70	225	380	0.326	0.308	SIA8C_HUMAN Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA3 PE=1 SV=3
13	Q6ZXA0	7.65e-48	167	359	0.276	0.276	SIA8A_XENLA Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Xenopus laevis OX=8355 GN=st8sia1 PE=1 SV=1
14	O15466	2.67e-47	166	376	0.267	0.255	SIA8E_HUMAN Alpha-2,8-sialyltransferase 8E OS=Homo sapiens OX=9606 GN=ST8SIA5 PE=1 SV=2
15	Q8K4T1	1.35e-46	165	398	0.287	0.259	SIA8F_MOUSE Alpha-2,8-sialyltransferase 8F OS=Mus musculus OX=10090 GN=St8sia6 PE=1 SV=1
16	Q92185	5.16e-46	162	356	0.256	0.258	SIA8A_HUMAN Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Homo sapiens OX=9606 GN=ST8SIA1 PE=1 SV=1
17	G3V7T2	7.31e-46	162	356	0.259	0.261	G3V7T2_RAT ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 OS=Rattus norvegicus OX=10116 GN=St8sia1 PE=3 SV=3
18	Q64687	1.10e-45	161	355	0.251	0.254	SIA8A_MOUSE Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase OS=Mus musculus OX=10090 GN=St8sia1 PE=1 SV=2
19	P61647	2.57e-43	156	398	0.240	0.216	SIA8F_HUMAN Alpha-2,8-sialyltransferase 8F OS=Homo sapiens OX=9606 GN=ST8SIA6 PE=2 SV=1
20	Q6ZXC8	2.70e-43	155	376	0.256	0.245	SIA8E_RAT Alpha-2,8-sialyltransferase 8E OS=Rattus norvegicus OX=10116 GN=St8sia5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00777 Glyco_transf_29	8.3e-74	260.1	Glycosyltransferase family 29 (sialyltransferase)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003828376.2

Rank	PPI partner	STRING score	Description
1	9597.XP_003825187.1	0.818	Beta-1,4-galactosyltransferase 4
2	9597.XP_008969803.1	0.814	Neural cell adhesion molecule 1 isoform X1
3	9597.XP_003811890.1	0.813	Beta-1,4-galactosyltransferase 3
4	9597.XP_003824423.1	0.808	Alpha-(1,3)-fucosyltransferase 9
5	9597.XP_003814055.1	0.693	Cytoplasmic polyadenylation element-binding protein 4 isoform X1
6	9597.XP_003831285.1	0.690	Cell adhesion molecule L1 like
7	9597.XP_003806990.1	0.657	Phosphodiesterase 4B
8	9597.XP_003804732.1	0.585	Progestin and adipoQ receptor family member 4
9	9597.XP_003828368.1	0.572	Solute carrier organic anion transporter family member 4C1
10	9597.XP_008970806.1	0.571	Neural cell adhesion molecule 2
11	9597.XP_008951958.1	0.568	Family with sequence similarity 174 member A
12	9597.XP_008970623.1	0.560	Mannosidase alpha class 2C member 1
13	9597.XP_003820650.1	0.528	Beta-1,3-galactosyltransferase 2
14	9597.XP_008972480.1	0.528	Belongs to the neuropilin family.
15	9597.XP_008966205.1	0.506	Chondroitin polymerizing factor 2
16	9597.XP_003818440.2	0.503	Belongs to the G-protein coupled receptor 2 family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008373	1.000	sialyltransferase activity
GO:0005488	0.864	binding
GO:0005515	0.804	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:1901137	0.987	carbohydrate derivative biosynthetic process
GO:1901566	0.986	organonitrogen compound biosynthetic process
GO:0044249	0.983	cellular biosynthetic process
GO:0009100	0.976	glycoprotein metabolic process
GO:0070085	0.951	glycosylation
GO:0009101	0.951	glycoprotein biosynthetic process
GO:0043412	0.937	macromolecule modification
GO:0043413	0.917	macromolecule glycosylation
GO:0036211	0.904	protein modification process
GO:0030148	0.896	sphingolipid biosynthetic process
GO:0032501	0.894	multicellular organismal process
GO:0048856	0.877	anatomical structure development
GO:0006688	0.875	glycosphingolipid biosynthetic process
GO:0005975	0.871	carbohydrate metabolic process
GO:0006486	0.844	protein glycosylation
GO:0007275	0.830	multicellular organism development
GO:0006491	0.787	N-glycan processing
GO:0006672	0.776	ceramide metabolic process
GO:0048731	0.694	system development
GO:0009311	0.567	oligosaccharide metabolic process
GO:0046513	0.380	ceramide biosynthetic process
GO:0065007	0.338	biological regulation
GO:0050794	0.317	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.999	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.-.-	1.000	Glycosyltransferases.

[back to server]