StarFunc result for job id Q92481

User Input

>input (460 residues)
MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGPYSSAPPLSHT
PSSDFQPPYFPPPYQPLPYHQSQDPYSHVNDPYSLNPLHQPQQHPWGQRQRQEVGSEAGS
LLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMGDSLSLHGLGHPGMEDVQ
SVEDANNSGMNLLDQSVIKKVPVPPKSVTSLMMNKDGFLGGMSVNTGEVFCSVPGRLSLL
SSTSKYKVTVGEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLRERLEKIGLNLPAGRR
KAANVTLLTSLVEGEAVHLARDFGYICETEFPAKAVSEYLNRQHTDPSDLHSRKNMLLAT
KQLCKEFTDLLAQDRTPIGNSRPSPILEPGIQSCLTHFSLITHGFGAPAICAALTALQNY
LTEALKGMDKMFLNNTTTNRHTSGEGPGSKTGDKEEKHRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92481	1.000	1.000	1.632E-63	460	1.000	1.000	Q92481.pdb.gz	AP2B_HUMAN Transcription factor AP-2-beta OS=Homo sapiens OX=9606 GN=TFAP2B PE=1 SV=2
2	AFDB:A0A2R8QRQ5	0.493	0.504	1.848E-41	450	0.700	0.716	A0A2R8QRQ5.pdb.gz	A0A2R8QRQ5_DANRE Transcription factor AP-2-alpha OS=Danio rerio OX=7955 GN=ap2 PE=1 SV=1
3	AFDB:Q61312	0.467	0.478	5.448E-37	449	0.543	0.557	Q61312.pdb.gz	AP2C_MOUSE Transcription factor AP-2 gamma OS=Mus musculus OX=10090 GN=Tfap2c PE=1 SV=2
4	AFDB:Q19862	0.426	0.369	2.742E-13	535	0.209	0.179	Q19862.pdb.gz	Q19862_CAEEL Transcription factor AP-2 C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=aptf-3 PE=1 SV=1
5	AFDB:P53890	0.101	0.103	3.105E-1	448	0.133	0.136	P53890.pdb.gz	BNI5_YEAST Bud neck protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BNI5 PE=1 SV=1
6	PDB:2jj1G	0.106	0.220	5.822E-1	167	0.041	0.114	2jj1G.pdb.gz	Mechanism of Inhibition of Bovine F1-ATPase by Resveratrol and Related Polyphenols.
7	AFDB:A0A024R8I0	0.083	0.070	8.337E-1	587	0.130	0.102	A0A024R8I0.pdb.gz
8	PDB:7qa8B	0.094	0.133	8.824E-1	299	0.065	0.100	7qa8B.pdb.gz	Activation mechanism of the class D fungal GPCR dimer Ste2.
9	PDB:2w6gG	0.117	0.274	1.031	140	0.033	0.107	2w6gG.pdb.gz
10	PDB:5sv0A	0.068	0.116	1.031	233	0.052	0.103	5sv0A.pdb.gz
11	AFDB:B0BF33	0.083	0.063	1.081	815	0.167	0.094	B0BF33.pdb.gz	PKP2_DANRE Plakophilin-2 OS=Danio rerio OX=7955 GN=pkp2 PE=2 SV=1
12	PDB:3jcfA	0.141	0.174	1.205	349	0.035	0.046	3jcfA.pdb.gz
13	PDB:7mqaLO	0.066	0.043	1.205	819	0.043	0.024	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	AFDB:Q9Y4G2	0.063	0.033	1.331	1056	0.089	0.039	Q9Y4G2.pdb.gz	PKHM1_HUMAN Pleckstrin homology domain-containing family M member 1 OS=Homo sapiens OX=9606 GN=PLEKHM1 PE=1 SV=3
15	AFDB:Q5VUA4	0.079	0.022	1.402	2279	0.135	0.027	Q5VUA4.pdb.gz	ZN318_HUMAN Zinc finger protein 318 OS=Homo sapiens OX=9606 GN=ZNF318 PE=1 SV=2
16	PDB:7khwA	0.109	0.234	1.734	174	0.052	0.138	7khwA.pdb.gz
17	PDB:7mtdC	0.103	0.068	1.734	783	0.057	0.033	7mtdC.pdb.gz
18	AFDB:A0A2R8QMN6	0.077	0.046	1.818	1069	0.135	0.058	A0A2R8QMN6.pdb.gz
19	PDB:2zdiC	0.089	0.258	1.924	148	0.039	0.122	2zdiC.pdb.gz
20	PDB:4p9uE	0.136	0.198	1.924	272	0.059	0.099	4p9uE.pdb.gz	The 40-residue insertion in Vibrio cholerae FadR facilitates binding of an additional fatty acyl-CoA ligand.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2KAT2	0.0	939	459	0.998	1.000	A0A0G2KAT2_RAT Transcription factor AP-2 beta OS=Rattus norvegicus OX=10116 GN=Tfap2b PE=3 SV=1
2	A0A2R8QRQ5	0.0	568	450	0.700	0.716	A0A2R8QRQ5_DANRE Transcription factor AP-2-alpha OS=Danio rerio OX=7955 GN=ap2 PE=1 SV=1
3	A0A6E1XE14	0.0	575	439	0.715	0.749	A0A6E1XE14_HUMAN Transcription factor AP-2-alpha OS=Homo sapiens OX=9606 GN=TFAP2A PE=1 SV=1
4	D4A505	0.0	881	441	0.939	0.980	D4A505_RAT Transcription factor AP-2 beta OS=Rattus norvegicus OX=10116 GN=Tfap2b PE=3 SV=2
5	F1QUT4	0.0	546	437	0.674	0.709	F1QUT4_DANRE Transcription factor AP-2-alpha OS=Danio rerio OX=7955 GN=ap2 PE=1 SV=1
6	O13111	0.0	566	437	0.711	0.748	O13111_CHICK Transcription factor AP-2-alpha OS=Gallus gallus OX=9031 PE=2 SV=2
7	O93346	0.0	910	449	0.957	0.980	O93346_CHICK Transcription factor AP-2 beta OS=Gallus gallus OX=9031 PE=2 SV=1
8	P05549	0.0	575	437	0.715	0.753	AP2A_HUMAN Transcription factor AP-2-alpha OS=Homo sapiens OX=9606 GN=TFAP2A PE=1 SV=1
9	P34056	0.0	573	437	0.715	0.753	AP2A_MOUSE Transcription factor AP-2-alpha OS=Mus musculus OX=10090 GN=Tfap2a PE=1 SV=2
10	P58197	0.0	572	437	0.715	0.753	AP2A_RAT Transcription factor AP-2-alpha OS=Rattus norvegicus OX=10116 GN=Tfap2a PE=1 SV=1
11	Q4TTV4	0.0	741	439	0.837	0.877	Q4TTV4_DANRE Transcription factor AP-2 beta isoform OS=Danio rerio OX=7955 GN=zgc:110163 PE=2 SV=1
12	Q61313	0.0	939	459	0.998	1.000	AP2B_MOUSE Transcription factor AP-2-beta OS=Mus musculus OX=10090 GN=Tfap2b PE=1 SV=2
13	Q6NYI3	0.0	544	425	0.674	0.729	Q6NYI3_DANRE Transcription factor AP-2-alpha OS=Danio rerio OX=7955 GN=ap2 PE=1 SV=1
14	Q92481	0.0	945	460	1.000	1.000	AP2B_HUMAN Transcription factor AP-2-beta OS=Homo sapiens OX=9606 GN=TFAP2B PE=1 SV=2
15	Q5PQZ4	7.84e-171	489	445	0.633	0.654	Q5PQZ4_DANRE Transcription factor AP-2 gamma OS=Danio rerio OX=7955 GN=fb48g05 PE=1 SV=1
16	Q61312	7.87e-161	464	449	0.585	0.599	AP2C_MOUSE Transcription factor AP-2 gamma OS=Mus musculus OX=10090 GN=Tfap2c PE=1 SV=2
17	Q6VUP9	2.43e-158	457	442	0.587	0.611	AP2E_MOUSE Transcription factor AP-2-epsilon OS=Mus musculus OX=10090 GN=Tfap2e PE=1 SV=2
18	Q92754	1.18e-157	456	450	0.589	0.602	AP2C_HUMAN Transcription factor AP-2 gamma OS=Homo sapiens OX=9606 GN=TFAP2C PE=1 SV=1
19	Q6P0E7	1.78e-155	449	423	0.602	0.655	AP2E_DANRE Transcription factor AP-2-epsilon OS=Danio rerio OX=7955 GN=tfap2e PE=2 SV=1
20	Q6VUC0	2.34e-153	444	442	0.572	0.595	AP2E_HUMAN Transcription factor AP-2-epsilon OS=Homo sapiens OX=9606 GN=TFAP2E PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03299 TF_AP-2	1.4e-79	278.1	Transcription factor AP-2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008571848.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008580488.1	0.877	BTB/POZ domain-containing protein KCTD1 isoform X1
2	482537.XP_008573452.1	0.845	YEATS domain-containing protein 4
3	482537.XP_008569740.1	0.842	BTB/POZ domain-containing protein KCTD15
4	482537.XP_008578096.1	0.782	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 8 Proteins, and 94% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
5	482537.XP_008564695.1	0.680	Nucleosome-remodeling factor subunit BPTF
6	482537.XP_008565146.1	0.674	Cbp/p300-interacting transactivator 2
7	482537.XP_008567647.1	0.658	WW domain-containing oxidoreductase
8	482537.XP_008576551.1	0.612	CREB-binding protein isoform X1
9	482537.XP_008572673.1	0.609	TGF-beta receptor type-2 isoform X1
10	482537.XP_008579441.1	0.605	SUMO-conjugating enzyme UBC9 isoform X1
11	482537.XP_008563818.1	0.604	Histone acetyltransferase p300-like
12	482537.XP_008572659.1	0.604	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments
13	482537.XP_008581573.1	0.593	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 13 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
14	482537.XP_008577371.1	0.590	Mast/stem cell growth factor receptor Kit isoform X1
15	482537.XP_008568806.1	0.571	Kelch repeat and BTB domain-containing protein 8
16	482537.XP_008588013.1	0.570	Receptor tyrosine-protein kinase erbB-2
17	482537.XP_008570722.1	0.567	Mothers against decapentaplegic homolog 3 isoform X1
18	482537.XP_008576881.1	0.567	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 mRNAs, 28 Proteins, and 95% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
19	482537.XP_008585262.1	0.562	Glutamate receptor-interacting protein 1-like
20	482537.XP_008587983.1	0.562	Glutamate receptor-interacting protein 1 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.999	transcription cis-regulatory region binding
GO:0005515	0.998	protein binding
GO:0003682	0.995	chromatin binding
GO:0000977	0.979	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.973	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001216	0.872	DNA-binding transcription activator activity
GO:0001228	0.863	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0042802	0.816	identical protein binding
GO:0046983	0.762	protein dimerization activity
GO:0046982	0.713	protein heterodimerization activity
GO:0042803	0.702	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.986	biological regulation
GO:0050794	0.983	regulation of cellular process
GO:0060255	0.967	regulation of macromolecule metabolic process
GO:0009987	0.963	cellular process
GO:0007275	0.958	multicellular organism development
GO:0009889	0.937	regulation of biosynthetic process
GO:0010468	0.936	regulation of gene expression
GO:0051171	0.928	regulation of nitrogen compound metabolic process
GO:0080090	0.926	regulation of primary metabolic process
GO:0031323	0.926	regulation of cellular metabolic process
GO:0050896	0.921	response to stimulus
GO:0006355	0.919	regulation of DNA-templated transcription
GO:0048513	0.870	animal organ development
GO:0048731	0.867	system development
GO:0048518	0.763	positive regulation of biological process
GO:0048519	0.752	negative regulation of biological process
GO:0048522	0.734	positive regulation of cellular process
GO:0042221	0.730	response to chemical
GO:0048523	0.718	negative regulation of cellular process
GO:0009893	0.614	positive regulation of metabolic process
GO:0010605	0.611	negative regulation of macromolecule metabolic process
GO:0010604	0.604	positive regulation of macromolecule metabolic process
GO:0006357	0.593	regulation of transcription by RNA polymerase II
GO:0031324	0.590	negative regulation of cellular metabolic process
GO:0051172	0.588	negative regulation of nitrogen compound metabolic process
GO:0051253	0.580	negative regulation of RNA metabolic process
GO:0010558	0.579	negative regulation of macromolecule biosynthetic process
GO:0031327	0.577	negative regulation of cellular biosynthetic process
GO:1902679	0.552	negative regulation of RNA biosynthetic process
GO:0051173	0.521	positive regulation of nitrogen compound metabolic process
GO:0009410	0.516	response to xenobiotic stimulus
GO:0045892	0.512	negative regulation of DNA-templated transcription
GO:0031325	0.499	positive regulation of cellular metabolic process
GO:0045935	0.468	positive regulation of nucleobase-containing compound metabolic process
GO:0008152	0.407	metabolic process
GO:0051254	0.388	positive regulation of RNA metabolic process
GO:0009891	0.387	positive regulation of biosynthetic process
GO:0071704	0.338	organic substance metabolic process
GO:0044238	0.330	primary metabolic process
GO:0010646	0.310	regulation of cell communication
GO:1903508	0.303	positive regulation of nucleic acid-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.929	intracellular organelle lumen
GO:0031981	0.747	nuclear lumen
GO:0005654	0.587	nucleoplasm
GO:0005737	0.362	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]