StarFunc result for job id Q92496

User Input

>input (578 residues)
MLLLINVILTLWVSCANGQEVKPCDFPEIQHGGLYYKSLRRLYFPAAAGQSYSYYCDQNF
VTPSGSYWDYIHCTQDGWSPTVPCLRTCSKSDVEIENGFISESSSIYILNEETQYNCKPG
YATAEGNSSGSITCLQNGWSTQPICIKFCDMPVFENSRAKSNGMWFKLHDTLDYECYDGY
ESSYGNTTDSIVCGEDGWSHLPTCYNSSENCGPPPPISNGDTTSFPQKVYLPWSRVEYQC
QSYYELQGSKYVTCSNGDWSEPPRCISMKPCEFPEIQHGHLYYENTRRPYFPVATGQSYS
YYCDQNFVTPSGSYWDYIHCTQDGWLPTVPCLRTCSKSDIEIENGFISESSSIYILNKEI
QYKCKPGYATADGNSSGSITCLQNGWSAQPICIKFCDMPVFENSRAKSNGMRFKLHDTLD
YECYDGYEISYGNTTGSIVCGEDGWSHFPTCYNSSEKCGPPPPISNGDTTSFLLKVYVPQ
SRVEYQCQSYYELQGSNYVTCSNGEWSEPPRCIHPCIITEENMNKNNIQLKGKSDIKYYA
KTGDTIEFMCKLGYNANTSVLSFQAVCREGIVEYPRCE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92496	1.000	1.000	0.000	578	1.000	1.000	Q92496.pdb.gz	FHR4_HUMAN Complement factor H-related protein 4 OS=Homo sapiens OX=9606 GN=CFHR4 PE=1 SV=3
2	AFDB:P08603	0.209	0.099	3.607E-54	1231	0.439	0.206	P08603.pdb.gz	CFAH_HUMAN Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=4
3	AFDB:Q61408	0.210	0.151	4.374E-52	808	0.422	0.302	Q61408.pdb.gz	Q61408_MOUSE Complement factor H-related protein OS=Mus musculus OX=10090 GN=Cfhr4 PE=2 SV=1
4	AFDB:E9Q8B5	0.211	0.140	6.372E-52	879	0.436	0.287	E9Q8B5.pdb.gz	E9Q8B5_MOUSE Complement factor H-related 4 OS=Mus musculus OX=10090 GN=Cfhr4 PE=1 SV=1
5	AFDB:E9Q8B6	0.207	0.148	3.632E-51	820	0.429	0.302	E9Q8B6.pdb.gz	E9Q8B6_MOUSE Complement factor H-related 4 OS=Mus musculus OX=10090 GN=Cfhr4 PE=1 SV=1
6	AFDB:P06909	0.204	0.098	1.723E-48	1234	0.412	0.193	P06909.pdb.gz	CFAH_MOUSE Complement factor H OS=Mus musculus OX=10090 GN=Cfh PE=1 SV=2
7	AFDB:Q91YB6	0.208	0.099	7.760E-48	1236	0.434	0.203	Q91YB6.pdb.gz	Q91YB6_RAT Complement inhibitory factor H OS=Rattus norvegicus OX=10116 GN=Cfh PE=2 SV=1
8	AFDB:Q9BXR6	0.249	0.253	6.161E-46	569	0.370	0.376	Q9BXR6.pdb.gz	FHR5_HUMAN Complement factor H-related protein 5 OS=Homo sapiens OX=9606 GN=CFHR5 PE=1 SV=1
9	AFDB:Q8R0I8	0.236	0.265	6.769E-46	509	0.377	0.428	Q8R0I8.pdb.gz	Q8R0I8_MOUSE BC026782 protein OS=Mus musculus OX=10090 GN=Cfhr2 PE=2 SV=1
10	AFDB:Q07968	0.251	0.227	1.083E-45	669	0.315	0.272	Q07968.pdb.gz	F13B_MOUSE Coagulation factor XIII B chain OS=Mus musculus OX=10090 GN=F13b PE=1 SV=2
11	PDB:1haqA	0.168	0.089	4.972E-29	1213	0.429	0.204	1haqA.pdb.gz
12	PDB:2gsxA	0.174	0.117	1.872E-24	951	0.240	0.146	2gsxA.pdb.gz
13	PDB:2q7zA	0.197	0.077	2.500E-21	1931	0.263	0.079	2q7zA.pdb.gz
14	PDB:1c1zA	0.139	0.219	3.065E-14	326	0.131	0.233	1c1zA.pdb.gz
15	PDB:8a7eC	0.118	0.056	7.210E-10	1524	0.130	0.049	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
16	PDB:8a7dQ	0.175	0.327	1.860E-6	273	0.061	0.128	8a7dQ.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
17	PDB:2xwbF	0.128	0.108	4.764E-6	714	0.085	0.069	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
18	PDB:4e0sB	0.120	0.082	2.715E-5	898	0.076	0.049	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
19	PDB:3t5oA	0.139	0.099	3.956E-5	871	0.092	0.061	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
20	PDB:7nycC	0.110	0.083	2.477E-4	809	0.088	0.063	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q92496	0.0	1190	578	1.000	1.000	FHR4_HUMAN Complement factor H-related protein 4 OS=Homo sapiens OX=9606 GN=CFHR4 PE=1 SV=3
2	Q02985	2.87e-143	419	330	0.362	0.633	FHR3_HUMAN Complement factor H-related protein 3 OS=Homo sapiens OX=9606 GN=CFHR3 PE=1 SV=2
3	Q8R0I8	9.88e-116	355	509	0.358	0.407	Q8R0I8_MOUSE BC026782 protein OS=Mus musculus OX=10090 GN=Cfhr2 PE=2 SV=1
4	Q61407	1.70e-111	342	452	0.330	0.423	Q61407_MOUSE Complement factor H-related protein (Fragment) OS=Mus musculus OX=10090 GN=Cfhr2 PE=2 SV=1
5	Q9BXR6	2.25e-111	346	569	0.377	0.383	FHR5_HUMAN Complement factor H-related protein 5 OS=Homo sapiens OX=9606 GN=CFHR5 PE=1 SV=1
6	E9PUM5	1.97e-84	281	808	0.367	0.262	E9PUM5_MOUSE Complement factor H-related 4 OS=Mus musculus OX=10090 GN=Cfhr4 PE=1 SV=1
7	Q61408	4.38e-82	275	808	0.356	0.255	Q61408_MOUSE Complement factor H-related protein OS=Mus musculus OX=10090 GN=Cfhr4 PE=2 SV=1
8	Q5XJW6	1.36e-81	271	689	0.341	0.286	Q5XJW6_RAT Cfh protein OS=Rattus norvegicus OX=10116 GN=Cfh PE=1 SV=1
9	P08603	1.65e-80	277	1231	0.327	0.154	CFAH_HUMAN Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=4
10	Q0KHD2	4.17e-79	268	820	0.355	0.250	Q0KHD2_MOUSE Complement factor H-related protein C OS=Mus musculus OX=10090 GN=Cfhr4 PE=2 SV=1
11	E9Q8B6	4.58e-79	267	820	0.355	0.250	E9Q8B6_MOUSE Complement factor H-related 4 OS=Mus musculus OX=10090 GN=Cfhr4 PE=1 SV=1
12	Q0KHD3	9.39e-79	268	879	0.355	0.233	Q0KHD3_MOUSE Complement factor H-related protein C OS=Mus musculus OX=10090 GN=Cfhr4 PE=2 SV=1
13	B2RUG5	1.09e-78	267	878	0.355	0.233	B2RUG5_MOUSE EG214403 protein OS=Mus musculus OX=10090 GN=Cfhr4 PE=2 SV=1
14	E9Q8B5	1.09e-78	268	879	0.355	0.233	E9Q8B5_MOUSE Complement factor H-related 4 OS=Mus musculus OX=10090 GN=Cfhr4 PE=1 SV=1
15	Q03591	1.72e-76	247	330	0.220	0.385	FHR1_HUMAN Complement factor H-related protein 1 OS=Homo sapiens OX=9606 GN=CFHR1 PE=1 SV=2
16	Q91YB6	8.93e-76	263	1236	0.332	0.155	Q91YB6_RAT Complement inhibitory factor H OS=Rattus norvegicus OX=10116 GN=Cfh PE=2 SV=1
17	G3V9R2	3.83e-75	262	1235	0.330	0.155	G3V9R2_RAT Complement factor H OS=Rattus norvegicus OX=10116 GN=Cfh PE=4 SV=1
18	Q07968	1.14e-74	252	669	0.329	0.284	F13B_MOUSE Coagulation factor XIII B chain OS=Mus musculus OX=10090 GN=F13b PE=1 SV=2
19	P06909	8.90e-72	252	1234	0.343	0.160	CFAH_MOUSE Complement factor H OS=Mus musculus OX=10090 GN=Cfh PE=1 SV=2
20	P05160	5.41e-68	234	661	0.315	0.275	F13B_HUMAN Coagulation factor XIII B chain OS=Homo sapiens OX=9606 GN=F13B PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00084 Sushi	9.3e-57	200.7	Sushi repeat (SCR repeat)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356386

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245907	0.997	Complement C3
2	9606.ENSP00000255030	0.985	C-reactive protein
3	9606.ENSP00000416561	0.790	Complement factor B
4	9606.ENSP00000256785	0.756	Complement factor H-related protein 5
5	9606.ENSP00000247153	0.741	Properdin
6	9606.ENSP00000356395	0.656	Complement factor H-related protein 3
7	9606.ENSP00000314299	0.648	Complement factor H-related protein 1
8	9606.ENSP00000284061	0.603	Diacylglycerol kinase epsilon
9	9606.ENSP00000415941	0.575	Complement C4-B
10	9606.ENSP00000396688	0.561	Complement C4-A
11	9606.ENSP00000313875	0.560	Membrane cofactor protein
12	9606.ENSP00000436682	0.559	Age-related maculopathy susceptibility 2
13	9606.ENSP00000255416	0.539	Myosin-binding protein H
14	9606.ENSP00000243611	0.537	C4b-binding protein beta chain
15	9606.ENSP00000356375	0.532	Zinc finger and BTB domain-containing protein 41
16	9606.ENSP00000455229	0.527	tRNA-dihydrouridine(20) synthase [NAD(P)+]-like
17	9606.ENSP00000332340	0.512	Probable ATP-dependent RNA helicase DDX28

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005319	1.000	lipid transporter activity
GO:0001848	0.362	complement binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050896	0.994	response to stimulus
GO:0002682	0.991	regulation of immune system process
GO:0048583	0.986	regulation of response to stimulus
GO:0050776	0.982	regulation of immune response
GO:0048518	0.918	positive regulation of biological process
GO:0002376	0.907	immune system process
GO:0002697	0.903	regulation of immune effector process
GO:0002684	0.890	positive regulation of immune system process
GO:0048584	0.843	positive regulation of response to stimulus
GO:0044419	0.793	biological process involved in interspecies interaction between organisms
GO:0009605	0.729	response to external stimulus
GO:0050778	0.704	positive regulation of immune response
GO:0006955	0.692	immune response
GO:0006950	0.686	response to stress
GO:0002252	0.642	immune effector process
GO:0043207	0.636	response to external biotic stimulus
GO:0051707	0.634	response to other organism
GO:0006952	0.619	defense response
GO:0002253	0.605	activation of immune response
GO:0006959	0.577	humoral immune response
GO:0098542	0.564	defense response to other organism
GO:0050794	0.553	regulation of cellular process
GO:0006956	0.551	complement activation
GO:0002920	0.498	regulation of humoral immune response
GO:0048519	0.443	negative regulation of biological process
GO:0030449	0.427	regulation of complement activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005615	0.977	extracellular space
GO:0031982	0.875	vesicle
GO:0043230	0.866	extracellular organelle
GO:0065010	0.862	extracellular membrane-bounded organelle
GO:0070062	0.854	extracellular exosome
GO:0071944	0.849	cell periphery
GO:0016020	0.565	membrane
GO:0032991	0.521	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]