StarFunc result for job id Q92499

User Input

>input (740 residues)
MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPV
IQIVYETLKDQQEGKKGKTTIKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWH
GCRATKGLMKGKHYYEVSCHDQGLCRVGWSTMQASLDLGTDKFGFGFGGTGKKSHNKQFD
NYGEEFTMHDTIGCYLDIDKGHVKFSKNGKDLGLAFEIPPHMKNQALFPACVLKNAELKF
NFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAE
QTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTPGRLDDLVSTGKLN
LSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCSATLHSFDVKKLSE
KIMHFPTWVDLKGEDSVPDTVHHVVVPVNPKTDRLWERLGKSHIRTDDVHAKDNTRPGAN
SPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQF
SCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYV
HRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLS
EIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEK
EAQTSFLHLGYLPNQLFRTF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A3RJH1	0.955	0.955	0.000	740	1.000	1.000	A3RJH1.pdb.gz	A3RJH1_HUMAN ATP-dependent RNA helicase OS=Homo sapiens OX=9606 GN=DDX1 PE=2 SV=1
2	AFDB:Q9VNV3	0.867	0.882	0.000	727	0.588	0.598	Q9VNV3.pdb.gz	DDX1_DROME ATP-dependent RNA helicase Ddx1 OS=Drosophila melanogaster OX=7227 GN=Ddx1 PE=2 SV=1
3	AFDB:Q1ZR46	0.471	0.802	3.534E-33	427	0.203	0.351	Q1ZR46.pdb.gz	Q1ZR46_PHOAS Putative ATP-dependent RNA helicase, DEAD boxfamily protein OS=Photobacterium angustum (strain S14 / CCUG 15956) OX=314292 GN=VAS14_03298 PE=1 SV=1
4	AFDB:P25888	0.480	0.772	1.993E-32	454	0.201	0.328	P25888.pdb.gz	RHLE_ECOLI ATP-dependent RNA helicase RhlE OS=Escherichia coli (strain K12) OX=83333 GN=rhlE PE=1 SV=3
5	AFDB:Q9I689	0.478	0.551	4.732E-32	639	0.185	0.214	Q9I689.pdb.gz	Q9I689_PSEAE ATP-dependent RNA helicase RhlE OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=rhlE PE=3 SV=1
6	AFDB:Q55804	0.452	0.668	1.782E-31	492	0.197	0.297	Q55804.pdb.gz	CRHR_SYNY3 RNA helicase CrhR OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=crhR PE=1 SV=1
7	AFDB:P9WH05	0.447	0.579	2.007E-30	563	0.193	0.254	P9WH05.pdb.gz	DEAD_MYCTU ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=deaD PE=1 SV=1
8	AFDB:Q8L7S8	0.460	0.455	1.199E-29	748	0.185	0.183	Q8L7S8.pdb.gz	RH3_ARATH DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RH3 PE=1 SV=2
9	AFDB:P0A9P6	0.454	0.529	1.902E-29	629	0.205	0.242	P0A9P6.pdb.gz	DEAD_ECOLI ATP-dependent RNA helicase DeaD OS=Escherichia coli (strain K12) OX=83333 GN=deaD PE=1 SV=2
10	AFDB:A0A1D6LAB7	0.453	0.451	6.025E-29	743	0.178	0.178	A0A1D6LAB7.pdb.gz	RH3B_MAIZE DEAD-box ATP-dependent RNA helicase 3B, chloroplastic OS=Zea mays OX=4577 GN=RH3B PE=2 SV=1
11	PDB:7pliA	0.456	0.725	9.923E-26	457	0.173	0.280	7pliA.pdb.gz	Structural basis for RNA-duplex unwinding by the DEAD-box helicase DbpA.
12	PDB:1fuuB	0.266	0.507	5.971E-23	380	0.168	0.326	1fuuB.pdb.gz
13	PDB:3ex7C	0.456	0.832	1.126E-22	392	0.161	0.304	3ex7C.pdb.gz	Mechanism of ATP turnover inhibition in the EJC
14	PDB:7pq0B	0.209	0.384	1.786E-22	385	0.141	0.270	7pq0B.pdb.gz
15	PDB:7evoE	0.265	0.425	4.256E-21	455	0.153	0.248	7evoE.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
16	PDB:7oqbp	0.189	0.310	4.776E-21	444	0.114	0.189	7oqbp.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
17	PDB:7evnE	0.271	0.410	1.799E-20	486	0.153	0.233	7evnE.pdb.gz	Mechanisms of the RNA helicases DDX42 and DDX46 in human U2 snRNP assembly.
18	PDB:6qw65X	0.284	0.356	1.206E-19	583	0.153	0.194	6qw65X.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
19	PDB:5zwny	0.186	0.340	3.606E-19	399	0.124	0.231	5zwny.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
20	PDB:1xtkA	0.338	0.555	5.097E-19	382	0.146	0.283	1xtkA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087X2G1	0.0	1322	636	0.859	1.000	A0A087X2G1_HUMAN ATP-dependent RNA helicase OS=Homo sapiens OX=9606 GN=DDX1 PE=1 SV=2
2	A3RJH1	0.0	1542	740	1.000	1.000	A3RJH1_HUMAN ATP-dependent RNA helicase OS=Homo sapiens OX=9606 GN=DDX1 PE=2 SV=1
3	F1T0B3	0.0	1372	659	0.885	0.994	F1T0B3_HUMAN ATP-dependent RNA helicase OS=Homo sapiens OX=9606 GN=DDX1 PE=1 SV=1
4	Q91VR5	0.0	1516	740	0.976	0.976	DDX1_MOUSE ATP-dependent RNA helicase DDX1 OS=Mus musculus OX=10090 GN=Ddx1 PE=1 SV=1
5	Q92499	0.0	1542	740	1.000	1.000	DDX1_HUMAN ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1 PE=1 SV=2
6	Q9VNV3	0.0	876	727	0.585	0.596	DDX1_DROME ATP-dependent RNA helicase Ddx1 OS=Drosophila melanogaster OX=7227 GN=Ddx1 PE=2 SV=1
7	P25888	1.04e-48	180	454	0.158	0.258	RHLE_ECOLI ATP-dependent RNA helicase RhlE OS=Escherichia coli (strain K12) OX=83333 GN=rhlE PE=1 SV=3
8	Q9I689	6.93e-44	170	639	0.149	0.172	Q9I689_PSEAE ATP-dependent RNA helicase RhlE OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=rhlE PE=3 SV=1
9	Q19614	4.62e-43	163	433	0.111	0.189	TOFU2_CAEEL Protein tofu-2 OS=Caenorhabditis elegans OX=6239 GN=tofu-2 PE=2 SV=3
10	A0A1D6LAB7	7.71e-43	168	743	0.159	0.159	RH3B_MAIZE DEAD-box ATP-dependent RNA helicase 3B, chloroplastic OS=Zea mays OX=4577 GN=RH3B PE=2 SV=1
11	Q1ZR46	7.55e-41	157	427	0.149	0.258	Q1ZR46_PHOAS Putative ATP-dependent RNA helicase, DEAD boxfamily protein OS=Photobacterium angustum (strain S14 / CCUG 15956) OX=314292 GN=VAS14_03298 PE=1 SV=1
12	P9WH05	1.54e-40	159	563	0.138	0.181	DEAD_MYCTU ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=deaD PE=1 SV=1
13	O05855	7.97e-39	153	527	0.159	0.224	O05855_MYCTU Probable ATP-dependent RNA helicase RhlE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rhlE PE=1 SV=1
14	Q55804	9.93e-39	152	492	0.142	0.213	CRHR_SYNY3 RNA helicase CrhR OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=crhR PE=1 SV=1
15	Q84W89	1.28e-38	154	633	0.153	0.179	RH37_ARATH DEAD-box ATP-dependent RNA helicase 37 OS=Arabidopsis thaliana OX=3702 GN=RH37 PE=2 SV=2
16	Q12099	3.61e-38	149	399	0.172	0.318	FAL1_YEAST ATP-dependent RNA helicase FAL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FAL1 PE=1 SV=1
17	Q9LUW5	9.54e-38	151	616	0.142	0.170	RH53_ARATH DEAD-box ATP-dependent RNA helicase 53, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RH53 PE=1 SV=1
18	P24783	1.05e-37	150	546	0.150	0.203	DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DBP2 PE=1 SV=1
19	Q8L7S8	1.21e-37	152	748	0.147	0.146	RH3_ARATH DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RH3 PE=1 SV=2
20	Q9M2F9	1.36e-37	151	646	0.146	0.167	RH52_ARATH DEAD-box ATP-dependent RNA helicase 52 OS=Arabidopsis thaliana OX=3702 GN=RH52 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14617 CMS1	16	16.3	U3-containing 90S pre-ribosomal complex subunit
2	PF00270 DEAD	1.9e-76	267.2	DEAD/DEAH box helicase
3	PF19070 DUF5766	57	15.4	Family of unknown function (DUF5766)
4	PF00271 Helicase_C	4.4e-24	96.3	Helicase conserved C-terminal domain
5	PF04851 ResIII	25	16.3	Type III restriction enzyme, res subunit
6	PF00622 SPRY	4.8e-21	86.5	SPRY domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370745

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216038	0.999	tRNA-splicing ligase RtcB homolog
2	9606.ENSP00000261700	0.999	RNA transcription, translation and transport factor protein
3	9606.ENSP00000380734	0.999	Protein FAM98B
4	9606.ENSP00000238823	0.995	Protein FAM98A
5	9606.ENSP00000258457	0.984	Ashwin
6	9606.ENSP00000417677	0.951	Protein archease
7	9606.ENSP00000417078	0.941	ATP-dependent RNA helicase DHX36
8	9606.ENSP00000365439	0.936	Heterogeneous nuclear ribonucleoprotein K
9	9606.ENSP00000327487	0.926	tRNA-splicing endonuclease subunit Sen54
10	9606.ENSP00000284995	0.920	tRNA-splicing endonuclease subunit Sen2
11	9606.ENSP00000355299	0.920	tRNA-splicing endonuclease subunit Sen15
12	9606.ENSP00000397402	0.918	tRNA-splicing endonuclease subunit Sen34
13	9606.ENSP00000264255	0.898	Thioredoxin domain-containing protein 9
14	9606.ENSP00000384273	0.861	Transcription factor p65
15	9606.ENSP00000252530	0.838	Protein FAM98C
16	9606.ENSP00000356520	0.837	ATP-dependent RNA helicase A
17	9606.ENSP00000336741	0.831	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15
18	9606.ENSP00000384863	0.810	Exportin-1
19	9606.ENSP00000331745	0.767	Growth/differentiation factor 3
20	9606.ENSP00000362063	0.749	Cleavage stimulation factor subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003723	0.999	RNA binding
GO:0140657	0.939	ATP-dependent activity
GO:0003824	0.933	catalytic activity
GO:0003724	0.918	RNA helicase activity
GO:0003727	0.492	single-stranded RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0043170	0.992	macromolecule metabolic process
GO:0044238	0.989	primary metabolic process
GO:0034641	0.985	cellular nitrogen compound metabolic process
GO:1901360	0.984	organic cyclic compound metabolic process
GO:0046483	0.984	heterocycle metabolic process
GO:0006725	0.983	cellular aromatic compound metabolic process
GO:0050896	0.971	response to stimulus
GO:0090304	0.945	nucleic acid metabolic process
GO:0065007	0.881	biological regulation
GO:0010467	0.872	gene expression
GO:0016070	0.872	RNA metabolic process
GO:0050789	0.867	regulation of biological process
GO:0050794	0.824	regulation of cellular process
GO:0006950	0.698	response to stress
GO:0006396	0.690	RNA processing
GO:0019222	0.639	regulation of metabolic process
GO:0060255	0.583	regulation of macromolecule metabolic process
GO:0071840	0.538	cellular component organization or biogenesis
GO:0048518	0.455	positive regulation of biological process
GO:0010468	0.433	regulation of gene expression
GO:0048522	0.405	positive regulation of cellular process
GO:0044260	0.387	cellular macromolecule metabolic process
GO:0008380	0.382	RNA splicing
GO:0016043	0.355	cellular component organization
GO:0010604	0.318	positive regulation of macromolecule metabolic process
GO:0031323	0.306	regulation of cellular metabolic process
GO:0080090	0.301	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.999	nucleoplasm
GO:0032991	0.946	protein-containing complex
GO:0043232	0.881	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.4.13	0.918	RNA helicase.

[back to server]