StarFunc result for job id Q92502

User Input

>input (1023 residues)
MTLNNCASMKLEVHFQSKQNEDSEEEEQCTISSHWAFQQESKCWSPMGSSDLLAPPSPGL
PATSSCESVLTELSATSLPVITVSLPPEPADLPLPGRAPSSSDRPLLSPTQGQEGPQDKA
KKRHRNRSFLKHLESLRRKEKSGSQQAEPKHSPATSEKVSKASSFRSCRGFLSAGFYRAK
NWAATSAGGSGANTRKAWEAWPVASFRHPQWTHRGDCLVHVPGDHKPGTFPRSLSIESLC
PEDGHRLADWQPGRRWGCEGRRGSCGSTGSHASTYDNLPELYPAEPVMVGAEAEDEDDEE
SGGSYAHLDDILQHVWGLQQRVELWSRAMYPDLGPGDEEEEEATSSVEIATVEVKCQAEA
LSQMEVPAHGESPAWAQAEVQPAVLAPAQAPAEAEPVAQEEAEAPAPAPAPAPAQDSEQE
AHSGGEPTFASSLSVEEGHSISDTVASSSELDSSGNSMNEAEAAGPLAGLQASMPRERRD
SGVGASLTRPCRKLRWHSFQNSHRPSLNSESLEINRQFAGQINLLHKGSLLRLTAFMEKY
TVPHKQGWVWSMPKFMRRNKTPDYRGQHVFGVPPLIHVQRTGQPLPQSIQQAMRYLRSQC
LDQVGIFRKSGVKSRIQNLRQMNETSPDNVCYEGQSAYDVADLLKQYFRDLPEPIFTSKL
TTTFLQIYQLLPKDQWLAAAQAATLLLPDENREVLQTLLYFLSDIASAEENQMTAGNLAV
CLAPSIFHLNVSKKDSPSPRIKSKRSLIGRPGPRDLSDNMAATQGLSHMISDCKKLFQVP
QDMVLQLCSSYSAAELSPPGPALAELRQAQAAGVSLSLYMEENIQDLLRDAAERFKGWMS
VPGPQHTELACRKAPDGHPLRLWKASTEVAAPPAVVLHRVLRERALWDEDLLRAQVLEAL
MPGVELYHYVTDSMAPHPCRDFVVLRMWRSDLPRGGCLLVSQSLDPEQPVPESGVRALML
TSQYLMEPCGLGRSRLTHICRADLRGRSPDWYNKVFGHLCAMEVAKIRDSFPTLQAAGPE
TKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8JR05	0.459	0.205	1.730E-48	2351	0.297	0.129	A8JR05.pdb.gz	A8JR05_DROME Crossveinless c, isoform C OS=Drosophila melanogaster OX=7227 GN=cv-c PE=4 SV=1
2	PDB:2r55A	0.178	0.789	6.967E-11	208	0.036	0.178	2r55A.pdb.gz
3	PDB:6l1dA	0.161	0.731	9.410E-11	200	0.034	0.175	6l1dA.pdb.gz
4	PDB:5brlA	0.167	0.736	1.995E-10	210	0.035	0.171	5brlA.pdb.gz
5	PDB:6r3vA	0.177	0.856	2.097E-10	198	0.053	0.273	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
6	PDB:6serA	0.169	0.649	3.292E-10	245	0.040	0.167	6serA.pdb.gz
7	PDB:3cxlA	0.177	0.439	2.209E-9	402	0.045	0.114	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
8	PDB:5jcpA	0.159	0.439	4.923E-9	361	0.049	0.139	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
9	PDB:5c2kA	0.155	0.400	1.558E-8	382	0.040	0.107	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
10	PDB:1ln1A	0.161	0.685	2.002E-8	203	0.030	0.153	1ln1A.pdb.gz	Structure of human phosphatidylcholine transfer protein in complex with its ligand.
11	AFDB:P34288	0.169	0.110	2.762E-8	1605	0.148	0.094	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
12	PDB:1xa6A	0.167	0.416	6.660E-8	399	0.042	0.108	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
13	AFDB:Q8C170	0.176	0.076	6.806E-8	2542	0.132	0.053	Q8C170.pdb.gz	MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus OX=10090 GN=Myo9a PE=1 SV=2
14	AFDB:P39083	0.182	0.185	4.343E-7	1007	0.110	0.112	P39083.pdb.gz	RGA1_YEAST Rho-type GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RGA1 PE=1 SV=1
15	AFDB:Q5VT97	0.172	0.150	7.536E-7	1194	0.128	0.110	Q5VT97.pdb.gz	SYDE2_HUMAN Rho GTPase-activating protein SYDE2 OS=Homo sapiens OX=9606 GN=SYDE2 PE=1 SV=2
16	AFDB:Q9VDE9	0.163	0.127	1.377E-5	1330	0.152	0.117	Q9VDE9.pdb.gz	Q9VDE9_DROME FI04035p OS=Drosophila melanogaster OX=7227 GN=RhoGAP93B PE=2 SV=2
17	AFDB:Q57Y66	0.051	0.054	1.455E-2	845	0.111	0.135	Q57Y66.pdb.gz	Q57Y66_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.15M23.240 PE=4 SV=1
18	AFDB:Q9Y4F4	0.057	0.040	3.769E-2	1720	0.122	0.073	Q9Y4F4.pdb.gz	TGRM1_HUMAN TOG array regulator of axonemal microtubules protein 1 OS=Homo sapiens OX=9606 GN=TOGARAM1 PE=1 SV=4
19	AFDB:X2JC00	0.180	0.133	8.832E-2	1404	0.145	0.105	X2JC00.pdb.gz	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
20	AFDB:D3ZMG0	0.071	0.069	1.694E-1	1051	0.112	0.109	D3ZMG0.pdb.gz	D3ZMG0_RAT Serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Ulk1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q63744	0.0	684	1091	0.329	0.309	RHG07_RAT Rho GTPase-activating protein 7 OS=Rattus norvegicus OX=10116 GN=Dlc1 PE=1 SV=3
2	Q923Q2	0.0	714	1113	0.341	0.314	STA13_MOUSE StAR-related lipid transfer protein 13 OS=Mus musculus OX=10090 GN=Stard13 PE=1 SV=5
3	Q96QB1	0.0	674	1528	0.328	0.220	RHG07_HUMAN Rho GTPase-activating protein 7 OS=Homo sapiens OX=9606 GN=DLC1 PE=1 SV=4
4	Q9R0Z9	0.0	687	1092	0.329	0.309	RHG07_MOUSE Rho GTPase-activating protein 7 OS=Mus musculus OX=10090 GN=Dlc1 PE=1 SV=2
5	Q9Y3M8	0.0	700	1113	0.345	0.317	STA13_HUMAN StAR-related lipid transfer protein 13 OS=Homo sapiens OX=9606 GN=STARD13 PE=1 SV=2
6	Q9VFK2	3.72e-134	432	1017	0.228	0.229	Q9VFK2_DROME Crossveinless c, isoform A OS=Drosophila melanogaster OX=7227 GN=cv-c PE=2 SV=2
7	Q8SY28	8.47e-134	431	1017	0.227	0.228	Q8SY28_DROME RE02250p OS=Drosophila melanogaster OX=7227 GN=cv-c PE=2 SV=1
8	A8JR05	2.52e-129	436	2351	0.228	0.099	A8JR05_DROME Crossveinless c, isoform C OS=Drosophila melanogaster OX=7227 GN=cv-c PE=4 SV=1
9	Q20442	1.88e-81	291	1334	0.175	0.134	Q20442_CAEEL START domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gei-1 PE=1 SV=4
10	C7FZT8	5.75e-81	290	1341	0.175	0.133	C7FZT8_CAEEL START domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gei-1 PE=1 SV=1
11	Q20440	7.40e-81	291	1510	0.175	0.119	Q20440_CAEEL START domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gei-1 PE=1 SV=5
12	C0P276	6.43e-33	129	228	0.065	0.289	C0P276_CAEEL START domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gei-1 PE=4 SV=1
13	O54834	1.64e-18	94.0	987	0.062	0.064	RHG06_MOUSE Rho GTPase-activating protein 6 OS=Mus musculus OX=10090 GN=Arhgap6 PE=1 SV=3
14	O43182	1.94e-18	93.6	974	0.062	0.065	RHG06_HUMAN Rho GTPase-activating protein 6 OS=Homo sapiens OX=9606 GN=ARHGAP6 PE=1 SV=3
15	Q8K0Q5	1.14e-17	90.5	663	0.063	0.097	RHG18_MOUSE Rho GTPase-activating protein 18 OS=Mus musculus OX=10090 GN=Arhgap18 PE=1 SV=1
16	O43052	1.38e-17	90.9	1150	0.065	0.058	RGA1_SCHPO Rho-type GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rga1 PE=1 SV=1
17	B4DN07	1.82e-17	89.7	604	0.062	0.104	B4DN07_HUMAN Rho GTPase activating protein 6 OS=Homo sapiens OX=9606 GN=ARHGAP6 PE=1 SV=1
18	H7BYE6	2.26e-17	89.4	601	0.062	0.105	H7BYE6_HUMAN Rho GTPase activating protein 6 (Fragment) OS=Homo sapiens OX=9606 GN=ARHGAP6 PE=1 SV=1
19	Q8WVD2	7.11e-16	84.3	501	0.046	0.094	Q8WVD2_HUMAN MYO9B protein (Fragment) OS=Homo sapiens OX=9606 GN=MYO9B PE=2 SV=2
20	A0A8I6AIK5	2.16e-15	83.6	934	0.054	0.059	A0A8I6AIK5_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00620 RhoGAP	3e-32	123.0	RhoGAP domain
2	PF01852 START	9.5e-50	180.4	START domain
3	PF20175 Tra1_central	8.2e+02	10.0	Tra1 HEAT repeat central region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363727

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000171887	0.891	Tensin-1
2	9606.ENSP00000417573	0.831	Protein YIPF6
3	9606.ENSP00000462349	0.805	StAR-related lipid transfer protein 6
4	9606.ENSP00000430344	0.730	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1
5	9606.ENSP00000338030	0.701	StAR-related lipid transfer protein 7, mitochondrial
6	9606.ENSP00000268896	0.693	Phosphatidylcholine transfer protein
7	9606.ENSP00000335247	0.670	START domain-containing protein 10
8	9606.ENSP00000290607	0.666	StAR-related lipid transfer protein 9
9	9606.ENSP00000400175	0.654	Transforming protein RhoA
10	9606.ENSP00000360366	0.648	Acyl-coenzyme A thioesterase 11
11	9606.ENSP00000303246	0.639	Acyl-coenzyme A thioesterase 12
12	9606.ENSP00000296632	0.637	StAR-related lipid transfer protein 4
13	9606.ENSP00000304032	0.591	StAR-related lipid transfer protein 5
14	9606.ENSP00000369862	0.586	Collagen type IV alpha-3-binding protein
15	9606.ENSP00000230538	0.568	Laminin subunit alpha-4
16	9606.ENSP00000272233	0.551	Rho-related GTP-binding protein RhoB
17	9606.ENSP00000405841	0.530	Relaxin receptor 1
18	9606.ENSP00000326817	0.509	Leucine-rich repeat-containing protein 57
19	9606.ENSP00000444278	0.507	Transmembrane gamma-carboxyglutamic acid protein 1
20	9606.ENSP00000285735	0.502	Rho-related GTP-binding protein RhoC

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050789	0.992	regulation of biological process
GO:0009987	0.986	cellular process
GO:0050794	0.983	regulation of cellular process
GO:0051056	0.946	regulation of small GTPase mediated signal transduction
GO:0071840	0.565	cellular component organization or biogenesis
GO:0016043	0.556	cellular component organization
GO:0050896	0.444	response to stimulus
GO:0051716	0.329	cellular response to stimulus
GO:0048519	0.307	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.983	cytosol
GO:0043226	0.799	organelle
GO:0016020	0.726	membrane
GO:0043227	0.553	membrane-bounded organelle
GO:0043229	0.460	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]