StarFunc result for job id Q92503

User Input

>input (715 residues)
MVQKYQSPVRVYKYPFELIMAAYERRFPTCPLIPMFVGSDTVNEFKSEDGAIHVIERRCK
LDVDAPRLLKKIAGVDYVYFVQKNSLNSRERTLHIEAYNETFSNRVIINEHCCYTVHPEN
EDWTCFEQSASLDIKSFFGFESTVEKIAMKQYTSNIKKGKEIIEYYLRQLEEEGITFVPR
WSPPSITTSSETSSSSSKKQAASMAVVIPEAALKEGLSGDALSSPSAPEPVVGTPDDKLD
ADYIKRYLGDLTPLQESCLIRLRQWLQETHKGKIPKDEHILRFLRARDFNIDKAREIMCQ
SLTWRKQHQVDYILETWTPPQVLQDYYAGGWHHHDKDGRPLYVLRLGQMDTKGLVRALGE
EALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEV
VEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDK
EIIPDFLSGECMCEVPEGGLVPKSLYRTAEELENEDLKLWTETIYQSASVFKGAPHEILI
QIVDASSVITWDFDVCKGDIVFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQLIDKVWQ
LGRDYSMVESPLICKEGESVQGSHVTRWPGFYILQWKFHSMPACAASSLPRVDDVLASLQ
VSSHKCKVMYYTEVIGSEDFRGSMTSLESSHSGFSQLSAATTSSSQSHSSSMISR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43304	0.816	0.837	0.000	696	0.667	0.685	O43304.pdb.gz	S14L5_HUMAN SEC14-like protein 5 OS=Homo sapiens OX=9606 GN=SEC14L5 PE=1 SV=3
2	AFDB:Q92503	1.000	1.000	0.000	715	1.000	1.000	Q92503.pdb.gz	S14L1_HUMAN SEC14-like protein 1 OS=Homo sapiens OX=9606 GN=SEC14L1 PE=1 SV=2
3	AFDB:Q9VMD6	0.439	0.464	2.244E-76	659	0.445	0.483	Q9VMD6.pdb.gz	RETM_DROME Protein real-time OS=Drosophila melanogaster OX=7227 GN=retm PE=1 SV=2
4	AFDB:A0A024R1I5	0.430	0.714	3.237E-32	403	0.161	0.285	A0A024R1I5.pdb.gz
5	PDB:1olmE	0.413	0.692	4.989E-32	397	0.159	0.287	1olmE.pdb.gz	Supernatant Protein Factor in Complex with Rrr-Alpha-Tocopherylquinone: A Link between Oxidized Vitamin E and Cholesterol Biosynthesis
6	AFDB:Q9UDX3	0.432	0.717	5.473E-32	406	0.173	0.305	Q9UDX3.pdb.gz	S14L4_HUMAN SEC14-like protein 4 OS=Homo sapiens OX=9606 GN=SEC14L4 PE=1 SV=1
7	PDB:4tlgA	0.412	0.695	6.837E-32	396	0.171	0.308	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
8	AFDB:A2BIR0	0.417	0.711	3.821E-31	395	0.155	0.281	A2BIR0.pdb.gz	A2BIR0_DANRE SEC14-like lipid-binding 8 OS=Danio rerio OX=7955 GN=si:ch211-89f7.1 PE=4 SV=2
9	PDB:4uybA	0.424	0.709	1.106E-30	401	0.162	0.289	4uybA.pdb.gz
10	AFDB:Q9UDX4	0.417	0.699	1.497E-30	400	0.161	0.287	Q9UDX4.pdb.gz	S14L3_HUMAN SEC14-like protein 3 OS=Homo sapiens OX=9606 GN=SEC14L3 PE=1 SV=1
11	AFDB:O17907	0.337	0.612	2.396E-24	383	0.124	0.232	O17907.pdb.gz	CTG1_CAEEL Protein ctg-1 OS=Caenorhabditis elegans OX=6239 GN=ctg-1 PE=2 SV=2
12	AFDB:Q94C59	0.266	0.345	3.908E-22	540	0.130	0.172	Q94C59.pdb.gz	PATL4_ARATH Patellin-4 OS=Arabidopsis thaliana OX=3702 GN=PATL4 PE=1 SV=2
13	AFDB:Q9SCU1	0.296	0.498	1.177E-21	409	0.126	0.220	Q9SCU1.pdb.gz	PATL6_ARATH Patellin-6 OS=Arabidopsis thaliana OX=3702 GN=PATL6 PE=2 SV=1
14	PDB:6f0eA	0.314	0.709	2.904E-15	300	0.103	0.247	6f0eA.pdb.gz	Target Identification and Mechanism of Action of Picolinamide and Benzamide Chemotypes with Antifungal Properties.
15	PDB:3b7nA	0.325	0.731	4.697E-14	307	0.099	0.231	3b7nA.pdb.gz	Functional anatomy of phospholipid binding and regulation of phosphoinositide homeostasis by proteins of the sec14 superfamily
16	PDB:7wvtA	0.255	0.484	2.096E-10	364	0.092	0.181	7wvtA.pdb.gz	Structural basis of ligand recognition and transport by Sfh2, a yeast phosphatidylinositol transfer protein of the Sec14 superfamily.
17	PDB:5jqmC	0.215	0.616	1.186E-9	236	0.043	0.131	5jqmC.pdb.gz
18	PDB:3w68C	0.253	0.612	1.821E-8	252	0.073	0.206	3w68C.pdb.gz	Impaired alpha-TTP-PIPs interaction underlies familial vitamin E deficiency
19	PDB:1oizA	0.253	0.583	3.078E-8	265	0.076	0.204	1oizA.pdb.gz	The Molecular Basis of Vitamin E Retention: Structure of Human Alpha-Tocopherol Transfer Protein
20	PDB:4fmmB	0.243	0.504	6.093E-8	325	0.067	0.148	4fmmB.pdb.gz	Dimeric Sfh3 has structural changes in its binding pocket that are associated with a dimer-monomer state transformation induced by substrate binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43304	0.0	983	696	0.649	0.667	S14L5_HUMAN SEC14-like protein 5 OS=Homo sapiens OX=9606 GN=SEC14L5 PE=1 SV=3
2	Q92503	0.0	1487	715	1.000	1.000	S14L1_HUMAN SEC14-like protein 1 OS=Homo sapiens OX=9606 GN=SEC14L1 PE=1 SV=2
3	Q9VMD6	0.0	605	659	0.443	0.481	RETM_DROME Protein real-time OS=Drosophila melanogaster OX=7227 GN=retm PE=1 SV=2
4	Q9UDX3	1.09e-53	192	406	0.155	0.273	S14L4_HUMAN SEC14-like protein 4 OS=Homo sapiens OX=9606 GN=SEC14L4 PE=1 SV=1
5	Q99MS0	9.13e-52	187	403	0.144	0.256	S14L2_RAT SEC14-like protein 2 OS=Rattus norvegicus OX=10116 GN=Sec14l2 PE=1 SV=1
6	Q9UDX4	8.25e-51	184	400	0.147	0.263	S14L3_HUMAN SEC14-like protein 3 OS=Homo sapiens OX=9606 GN=SEC14L3 PE=1 SV=1
7	O76054	1.38e-50	183	403	0.141	0.251	S14L2_HUMAN SEC14-like protein 2 OS=Homo sapiens OX=9606 GN=SEC14L2 PE=1 SV=1
8	A2BIR0	3.20e-50	182	395	0.143	0.258	A2BIR0_DANRE SEC14-like lipid-binding 8 OS=Danio rerio OX=7955 GN=si:ch211-89f7.1 PE=4 SV=2
9	C9JZI9	1.35e-36	138	203	0.088	0.310	C9JZI9_HUMAN SEC14 like lipid binding 2 (Fragment) OS=Homo sapiens OX=9606 GN=SEC14L2 PE=1 SV=1
10	B3KRD8	1.67e-34	136	329	0.105	0.228	B3KRD8_HUMAN SEC14 like lipid binding 2 OS=Homo sapiens OX=9606 GN=SEC14L2 PE=1 SV=1
11	Q93ZE9	1.34e-33	138	548	0.122	0.159	SFH3_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH3 OS=Arabidopsis thaliana OX=3702 GN=SFH3 PE=2 SV=1
12	F4JLE5	3.77e-32	134	554	0.110	0.143	SFH1_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH1 OS=Arabidopsis thaliana OX=3702 GN=SFH1 PE=2 SV=1
13	F4JVA9	6.73e-32	133	554	0.110	0.143	SFH2_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH2 OS=Arabidopsis thaliana OX=3702 GN=SFH2 PE=3 SV=1
14	F4HZ25	2.44e-27	120	668	0.103	0.111	F4HZ25_ARATH Sec14p-like phosphatidylinositol transfer family protein OS=Arabidopsis thaliana OX=3702 GN=At1g75370 PE=1 SV=1
15	O17907	3.05e-25	110	383	0.113	0.211	CTG1_CAEEL Protein ctg-1 OS=Caenorhabditis elegans OX=6239 GN=ctg-1 PE=2 SV=2
16	P24280	3.95e-25	108	304	0.112	0.263	SEC14_YEAST SEC14 cytosolic factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC14 PE=1 SV=3
17	Q10137	5.96e-25	107	286	0.109	0.273	SEC14_SCHPO Sec14 cytosolic factor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec14 PE=4 SV=1
18	P33324	1.63e-24	107	310	0.106	0.245	YKJ1_YEAST CRAL-TRIO domain-containing protein YKL091C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YKL091C PE=1 SV=2
19	P53989	1.19e-22	101	302	0.101	0.238	SEC14_CANGA SEC14 cytosolic factor OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SEC14 PE=3 SV=1
20	P46250	2.76e-19	91.3	301	0.105	0.249	SEC14_CANAL SEC14 cytosolic factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SEC14 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00650 CRAL_TRIO	5.6e-36	135.2	CRAL/TRIO domain
2	PF03765 CRAL_TRIO_N	0.052	25.0	CRAL/TRIO, N-terminal domain
3	PF04707 PRELI	1.5e-49	179.3	PRELI-like family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376268

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000482732	0.917	Tyrosine-protein phosphatase non-receptor type 9
2	9606.ENSP00000391249	0.820	Septin-9
3	9606.ENSP00000415332	0.714	SEC14 domain and spectrin repeat-containing protein 1
4	9606.ENSP00000402153	0.650	IQ motif containing J
5	9606.ENSP00000363229	0.585	Vesicular acetylcholine transporter
6	9606.ENSP00000388996	0.560	AP-1 complex subunit mu-1
7	9606.ENSP00000402000	0.558	Septin-4
8	9606.ENSP00000364568	0.556	Putative uncharacterized protein C9orf129
9	9606.ENSP00000301634	0.539	Thymidine kinase, cytosolic
10	9606.ENSP00000264047	0.528	High affinity choline transporter 1
11	9606.ENSP00000366886	0.521	Kelch-like protein 21
12	9606.ENSP00000479861	0.507	Septin-2
13	9606.ENSP00000264893	0.502	Septin-11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0097159	0.438	organic cyclic compound binding
GO:0039552	0.436	RIG-I binding
GO:1901363	0.311	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0015697	0.994	quaternary ammonium group transport
GO:0002832	0.993	negative regulation of response to biotic stimulus
GO:0062207	0.993	regulation of pattern recognition receptor signaling pathway
GO:0048523	0.982	negative regulation of cellular process
GO:0015695	0.982	organic cation transport
GO:0002683	0.980	negative regulation of immune system process
GO:0050687	0.978	negative regulation of defense response to virus
GO:0039531	0.973	regulation of viral-induced cytoplasmic pattern recognition receptor signaling pathway
GO:0009968	0.970	negative regulation of signal transduction
GO:0009987	0.751	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.997	endomembrane system
GO:0005829	0.997	cytosol
GO:0005634	0.996	nucleus
GO:0005654	0.989	nucleoplasm
GO:0005794	0.967	Golgi apparatus
GO:0016020	0.811	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]