StarFunc result for job id Q92508

User Input

>input (2521 residues)
MEPHVLGAVLYWLLLPCALLAACLLRFSGLSLVYLLFLLLLPWFPGPTRCGLQGHTGRLL
RALLGLSLLFLVAHLALQICLHIVPRLDQLLGPSCSRWETLSRHIGVTRLDLKDIPNAIR
LVAPDLGILVVSSVCLGICGRLARNTRQSPHPRELDDDERDVDASPTAGLQEAATLAPTR
RSRLAARFRVTAHWLLVAAGRVLAVTLLALAGIAHPSALSSVYLLLFLALCTWWACHFPI
STRGFSRLCVAVGCFGAGHLICLYCYQMPLAQALLPPAGIWARVLGLKDFVGPTNCSSPH
ALVLNTGLDWPVYASPGVLLLLCYATASLRKLRAYRPSGQRKEAAKGYEARELELAELDQ
WPQERESDQHVVPTAPDTEADNCIVHELTGQSSVLRRPVRPKRAEPREASPLHSLGHLIM
DQSYVCALIAMMVWSITYHSWLTFVLLLWACLIWTVRSRHQLAMLCSPCILLYGMTLCCL
RYVWAMDLRPELPTTLGPVSLRQLGLEHTRYPCLDLGAMLLYTLTFWLLLRQFVKEKLLK
WAESPAALTEVTVADTEPTRTQTLLQSLGELVKGVYAKYWIYVCAGMFIVVSFAGRLVVY
KIVYMFLFLLCLTLFQVYYSLWRKLLKAFWWLVVAYTMLVLIAVYTFQFQDFPAYWRNLT
GFTDEQLGDLGLEQFSVSELFSSILVPGFFLLACILQLHYFHRPFMQLTDMEHVSLPGTR
LPRWAHRQDAVSGTPLLREEQQEHQQQQQEEEEEEEDSRDEGLGVATPHQATQVPEGAAK
WGLVAERLLELAAGFSDVLSRVQVFLRRLLELHVFKLVALYTVWVALKEVSVMNLLLVVL
WAFALPYPRFRPMASCLSTVWTCVIIVCKMLYQLKVVNPQEYSSNCTEPFPNSTNLLPTE
ISQSLLYRGPVDPANWFGVRKGFPNLGYIQNHLQVLLLLVFEAIVYRRQEHYRRQHQLAP
LPAQAVFASGTRQQLDQDLLGCLKYFINFFFYKFGLEICFLMAVNVIGQRMNFLVTLHGC
WLVAILTRRHRQAIARLWPNYCLFLALFLLYQYLLCLGMPPALCIDYPWRWSRAVPMNSA
LIKWLYLPDFFRAPNSTNLISDFLLLLCASQQWQVFSAERTEEWQRMAGVNTDRLEPLRG
EPNPVPNFIHCRSYLDMLKVAVFRYLFWLVLVVVFVTGATRISIFGLGYLLACFYLLLFG
TALLQRDTRARLVLWDCLILYNVTVIISKNMLSLLACVFVEQMQTGFCWVIQLFSLVCTV
KGYYDPKEMMDRDQDCLLPVEEAGIIWDSVCFFFLLLQRRVFLSHYYLHVRADLQATALL
ASRGFALYNAANLKSIDFHRRIEEKSLAQLKRQMERIRAKQEKHRQGRVDRSRPQDTLGP
KDPGLEPGPDSPGGSSPPRRQWWRPWLDHATVIHSGDYFLFESDSEEEEEAVPEDPRPSA
QSAFQLAYQAWVTNAQAVLRRRQQEQEQARQEQAGQLPTGGGPSQEVEPAEGPEEAAAGR
SHVVQRVLSTAQFLWMLGQALVDELTRWLQEFTRHHGTMSDVLRAERYLLTQELLQGGEV
HRGVLDQLYTSQAEATLPGPTEAPNAPSTVSSGLGAEEPLSSMTDDMGSPLSTGYHTRSG
SEEAVTDPGEREAGASLYQGLMRTASELLLDRRLRIPELEEAELFAEGQGRALRLLRAVY
QCVAAHSELLCYFIIILNHMVTASAGSLVLPVLVFLWAMLSIPRPSKRFWMTAIVFTEIA
VVVKYLFQFGFFPWNSHVVLRRYENKPYFPPRILGLEKTDGYIKYDLVQLMALFFHRSQL
LCYGLWDHEEDSPSKEHDKSGEEEQGAEEGPGVPAATTEDHIQVEARVGPTDGTPEPQVE
LRPRDTRRISLRFRRRKKEGPARKGAAAIEAEDREEEEGEEEKEAPTGREKRPSRSGGRV
RAAGRRLQGFCLSLAQGTYRPLRRFFHDILHTKYRAATDVYALMFLADVVDFIIIIFGFW
AFGKHSAATDITSSLSDDQVPEAFLVMLLIQFSTMVVDRALYLRKTVLGKLAFQVALVLA
IHLWMFFILPAVTERMFNQNVVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTKKYNH
LNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSSWMCVEDIYANIFIIKCSRETEKKYP
QPKGQKKKKIVKYGMGGLIILFLIAIIWFPLLFMSLVRSVVGVVNQPIDVTVTLKLGGYE
PLFTMSAQQPSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRI
SPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLAS
LLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGF
LEWWVIELQECRTDCNLLPMVIFSDKVSPPSLGFLAGYGIMGLYVSIVLVIGKFVRGFFS
EISHSIMFEELPCVDRILKLCQDIFLVRETRELELEEELYAKLIFLYRSPETMIKWTREK
E

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5z10A	0.484	0.908	0.000	1304	0.472	0.912	5z10A.pdb.gz
2	PDB:6b3rA	0.558	0.916	0.000	1502	0.537	0.902	6b3rA.pdb.gz	Structure-based membrane dome mechanism for Piezo mechanosensitivity.
3	PDB:6kg7A	0.644	0.881	0.000	1817	0.395	0.548	6kg7A.pdb.gz
4	PDB:7wltA	0.518	0.948	0.000	1353	0.488	0.908	7wltA.pdb.gz	Structure deformation and curvature sensing of PIEZO1 in lipid membranes.
5	PDB:7wluA	0.441	0.707	0.000	1498	0.538	0.906	7wluA.pdb.gz	Structure deformation and curvature sensing of PIEZO1 in lipid membranes.
6	AFDB:A0A061ACU2	0.479	0.493	0.000	2442	0.263	0.272	A0A061ACU2.pdb.gz	PIEZ1_CAEEL Piezo-type mechanosensitive ion channel component 1 OS=Caenorhabditis elegans OX=6239 GN=pezo-1 PE=1 SV=1
7	AFDB:E2JF22	0.741	0.735	0.000	2547	0.820	0.811	E2JF22.pdb.gz	PIEZ1_MOUSE Piezo-type mechanosensitive ion channel component 1 OS=Mus musculus OX=10090 GN=Piezo1 PE=1 SV=1
8	AFDB:E7FD74	0.847	0.875	0.000	2436	0.576	0.596	E7FD74.pdb.gz
9	AFDB:M9MSG8	0.456	0.451	0.000	2551	0.288	0.285	M9MSG8.pdb.gz	PIEZO_DROME Piezo-type mechanosensitive ion channel component OS=Drosophila melanogaster OX=7227 GN=Piezo PE=2 SV=1
10	AFDB:Q92508	1.000	1.000	0.000	2521	1.000	1.000	Q92508.pdb.gz	PIEZ1_HUMAN Piezo-type mechanosensitive ion channel component 1 OS=Homo sapiens OX=9606 GN=PIEZO1 PE=1 SV=4
11	AFDB:Q7KU89	0.032	0.035	1.182E-1	1904	0.041	0.054	Q7KU89.pdb.gz	Q7KU89_DROME Puratrophin-1-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Pura PE=4 SV=2
12	AFDB:Q9JIS7	0.047	0.054	4.638E-1	1985	0.083	0.105	Q9JIS7.pdb.gz	CAC1F_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1F OS=Mus musculus OX=10090 GN=Cacna1f PE=1 SV=1
13	PDB:4anjA	0.029	0.045	7.181E-1	995	0.021	0.053	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
14	AFDB:Q9R0L6	0.032	0.037	8.284E-1	2025	0.034	0.042	Q9R0L6.pdb.gz	PCM1_MOUSE Pericentriolar material 1 protein OS=Mus musculus OX=10090 GN=Pcm1 PE=1 SV=2
15	AFDB:Q5FBC3	0.045	0.057	9.380E-1	1416	0.067	0.119	Q5FBC3.pdb.gz	TMCB_DICDI Tiny macrocysts protein B OS=Dictyostelium discoideum OX=44689 GN=tmcB PE=2 SV=1
16	PDB:6u9wA	0.034	0.094	1.087	562	0.015	0.068	6u9wA.pdb.gz	Full-Length P2X7Structures Reveal How Palmitoylation Prevents Channel Desensitization.
17	AFDB:Q5T626	0.031	0.088	1.107	449	0.027	0.154	Q5T626.pdb.gz	Q5T626_HUMAN Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=2 SV=1
18	PDB:5svkA	0.042	0.154	1.452	357	0.014	0.098	5svkA.pdb.gz	X-ray structures define human P2X3 receptor gating cycle and antagonist action.
19	PDB:1wnhA	0.020	0.096	1.862	220	0.005	0.055	1wnhA.pdb.gz
20	PDB:4u4tA	0.040	0.130	2.291	444	0.021	0.122	4u4tA.pdb.gz	Structural basis for dynamic mechanism of nitrate/nitrite antiport by NarK

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E2JF22	0.0	3909	2547	0.821	0.813	PIEZ1_MOUSE Piezo-type mechanosensitive ion channel component 1 OS=Mus musculus OX=10090 GN=Piezo1 PE=1 SV=1
2	Q8CD54	0.0	1023	2822	0.225	0.201	PIEZ2_MOUSE Piezo-type mechanosensitive ion channel component 2 OS=Mus musculus OX=10090 GN=Piezo2 PE=1 SV=2
3	Q92508	0.0	5167	2521	1.000	1.000	PIEZ1_HUMAN Piezo-type mechanosensitive ion channel component 1 OS=Homo sapiens OX=9606 GN=PIEZO1 PE=1 SV=4
4	M9MSG8	1.69e-153	536	2551	0.122	0.121	PIEZO_DROME Piezo-type mechanosensitive ion channel component OS=Drosophila melanogaster OX=7227 GN=Piezo PE=2 SV=1
5	A0A061ACU2	8.84e-127	450	2442	0.115	0.118	PIEZ1_CAEEL Piezo-type mechanosensitive ion channel component 1 OS=Caenorhabditis elegans OX=6239 GN=pezo-1 PE=1 SV=1
6	Q54S52	2.27e-54	214	3080	0.069	0.057	Y2801_DICDI Protein PIEZO homolog OS=Dictyostelium discoideum OX=44689 GN=DDB_G0282801 PE=3 SV=1
7	F4IN58	1.62e-51	204	2462	0.075	0.077	PIEZO_ARATH Piezo-type mechanosensitive ion channel homolog OS=Arabidopsis thaliana OX=3702 GN=At2g48060/At2g48040/At2g48050 PE=2 SV=1
8	P15389	0.27	39.3	2019	0.011	0.013	SCN5A_RAT Sodium channel protein type 5 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn5a PE=1 SV=1
9	P28667	0.38	37.4	200	0.010	0.120	MRP_MOUSE MARCKS-related protein OS=Mus musculus OX=10090 GN=Marcksl1 PE=1 SV=2
10	O01761	0.45	38.5	8081	0.012	0.004	UNC89_CAEEL Muscle M-line assembly protein unc-89 OS=Caenorhabditis elegans OX=6239 GN=unc-89 PE=1 SV=3
11	Q9GLG4	0.70	37.7	668	0.011	0.042	SCG1_PIG Secretogranin-1 OS=Sus scrofa OX=9823 GN=CHGB PE=1 SV=1
12	Q9EPH2	1.6	35.4	199	0.009	0.116	MRP_RAT MARCKS-related protein OS=Rattus norvegicus OX=10116 GN=Marcksl1 PE=2 SV=3
13	O82587	2.5	35.4	285	0.017	0.151	SWT12_ARATH Bidirectional sugar transporter SWEET12 OS=Arabidopsis thaliana OX=3702 GN=SWEET12 PE=1 SV=1
14	B2RVW2	3.0	34.7	232	0.009	0.099	CLRN2_MOUSE Clarin-2 OS=Mus musculus OX=10090 GN=Clrn2 PE=2 SV=1
15	O94707	3.0	35.4	351	0.009	0.063	RXT3_SCHPO Transcriptional regulatory protein rxt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rxt3 PE=1 SV=1
16	A0A1P8AUY4	3.6	35.4	5400	0.011	0.005	MDN1_ARATH Midasin OS=Arabidopsis thaliana OX=3702 GN=MDN1 PE=1 SV=1
17	Q57V67	4.7	34.7	503	0.012	0.062	Q57V67_TRYB2 Serine/threonine-protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.210 PE=4 SV=1
18	Q05152	6.2	34.7	2339	0.011	0.012	CAC1B_RABIT Voltage-dependent N-type calcium channel subunit alpha-1B OS=Oryctolagus cuniculus OX=9986 GN=CACNA1B PE=1 SV=1
19	O43493	6.9	34.3	437	0.012	0.071	TGON2_HUMAN Trans-Golgi network integral membrane protein 2 OS=Homo sapiens OX=9606 GN=TGOLN2 PE=1 SV=4
20	A0A5F9UY30	7.0	34.3	453	0.012	0.068	A0A5F9UY30_HUMAN Trans-golgi network protein 2 OS=Homo sapiens OX=9606 GN=TGOLN2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15917 PIEZO	1e-93	324.5	Piezo
2	PF12166 Piezo_RRas_bdg	1.9e-151	516.8	Piezo non-specific cation channel, R-Ras-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301015

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286713	0.798	Erythrocyte band 7 integral membrane protein
2	9606.ENSP00000368952	0.773	Stomatin-like protein 3
3	9606.ENSP00000406191	0.741	Transient receptor potential cation channel subfamily V member 4
4	9606.ENSP00000394033	0.714	Potassium channel subfamily K member 2
5	9606.ENSP00000440045	0.683	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2
6	9606.ENSP00000444948	0.681	Potassium channel subfamily K member 4
7	9606.ENSP00000249923	0.644	Coatomer subunit beta
8	9606.ENSP00000237596	0.642	Polycystin-2
9	9606.ENSP00000253925	0.629	Liprin-alpha-1
10	9606.ENSP00000420919	0.610	Transmembrane protein 150C
11	9606.ENSP00000262888	0.599	Intermediate conductance calcium-activated potassium channel protein 4
12	9606.ENSP00000351732	0.596	Transmembrane channel-like protein 2
13	9606.ENSP00000291527	0.595	Trefoil factor 1
14	9606.ENSP00000300069	0.592	RNA-binding protein with multiple splicing 2
15	9606.ENSP00000314724	0.592	Liprin-beta-1
16	9606.ENSP00000262209	0.589	Transient receptor potential cation channel subfamily A member 1
17	9606.ENSP00000354006	0.577	Transient receptor potential cation channel subfamily M member 6
18	9606.ENSP00000419313	0.558	Short transient receptor potential channel 1
19	9606.ENSP00000353346	0.555	LHFPL tetraspan subfamily member 5 protein
20	9606.ENSP00000245503	0.554	Myosin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008381	0.995	mechanosensitive monoatomic ion channel activity
GO:0005261	0.976	monoatomic cation channel activity
GO:0042802	0.728	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.987	biological regulation
GO:0010830	0.982	regulation of myotube differentiation
GO:0051149	0.873	positive regulation of muscle cell differentiation
GO:0009987	0.848	cellular process
GO:0050896	0.681	response to stimulus
GO:0051179	0.678	localization
GO:0051155	0.672	positive regulation of striated muscle cell differentiation
GO:0030155	0.625	regulation of cell adhesion
GO:0051234	0.623	establishment of localization
GO:0006810	0.596	transport
GO:0006811	0.445	monoatomic ion transport
GO:0006812	0.423	monoatomic cation transport
GO:0032501	0.315	multicellular organismal process
GO:0022407	0.314	regulation of cell-cell adhesion
GO:0033628	0.306	regulation of cell adhesion mediated by integrin
GO:0045785	0.304	positive regulation of cell adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005886	0.990	plasma membrane
GO:0005622	0.989	intracellular anatomical structure
GO:0043226	0.987	organelle
GO:0012505	0.987	endomembrane system
GO:0043227	0.962	membrane-bounded organelle
GO:0005737	0.959	cytoplasm
GO:0043229	0.947	intracellular organelle
GO:0043231	0.939	intracellular membrane-bounded organelle
GO:0005783	0.557	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]