StarFunc result for job id Q92519

User Input

>input (343 residues)
MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSC
IGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEII
LGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRK
FIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSL
GVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQ
EILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q28283	0.810	0.810	4.957E-62	343	0.997	0.997	Q28283.pdb.gz	TRIB2_CANLF Tribbles homolog 2 OS=Canis lupus familiaris OX=9615 GN=TRIB2 PE=2 SV=1
2	AFDB:F1QCV8	0.753	0.743	6.526E-45	348	0.534	0.526	F1QCV8.pdb.gz
3	AFDB:Q8K4K4	0.751	0.694	9.604E-44	372	0.569	0.524	Q8K4K4.pdb.gz	TRIB1_MOUSE Tribbles homolog 1 OS=Mus musculus OX=10090 GN=Trib1 PE=2 SV=2
4	AFDB:A0A2R8QE16	0.770	0.757	7.532E-43	349	0.496	0.487	A0A2R8QE16.pdb.gz	A0A2R8QE16_DANRE Tribbles homolog 1 OS=Danio rerio OX=7955 GN=trib1 PE=4 SV=1
5	AFDB:Q8K4K2	0.760	0.737	8.095E-40	354	0.490	0.475	Q8K4K2.pdb.gz	TRIB3_MOUSE Tribbles homolog 3 OS=Mus musculus OX=10090 GN=Trib3 PE=1 SV=2
6	AFDB:J3KR25	0.811	0.724	1.498E-38	385	0.461	0.410	J3KR25.pdb.gz	J3KR25_HUMAN Tribbles pseudokinase 3 OS=Homo sapiens OX=9606 GN=TRIB3 PE=1 SV=1
7	AFDB:Q9V3Z1	0.583	0.424	4.991E-26	484	0.347	0.246	Q9V3Z1.pdb.gz	TRIB_DROME Tribbles OS=Drosophila melanogaster OX=7227 GN=trbl PE=1 SV=1
8	AFDB:O13945	0.682	0.450	2.178E-24	532	0.248	0.160	O13945.pdb.gz	PPK9_SCHPO Protein kinase domain-containing protein ppk9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk9 PE=4 SV=1
9	AFDB:J3KR84	0.664	0.262	2.738E-24	909	0.230	0.087	J3KR84.pdb.gz	J3KR84_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens OX=9606 GN=PLK4 PE=1 SV=1
10	AFDB:Q00372	0.682	0.391	3.070E-24	612	0.254	0.142	Q00372.pdb.gz	SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SNF1 PE=3 SV=2
11	PDB:5u6yA	0.637	0.484	1.028E-22	459	0.254	0.190	5u6yA.pdb.gz
12	PDB:4zhxA	0.660	0.558	1.073E-21	409	0.224	0.188	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
13	PDB:7myjC	0.669	0.500	2.531E-21	465	0.239	0.176	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
14	PDB:4rerA	0.678	0.513	6.695E-21	459	0.219	0.163	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
15	PDB:4rewA	0.674	0.567	8.416E-21	411	0.224	0.187	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
16	PDB:6b1uA	0.664	0.521	9.992E-21	442	0.224	0.174	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
17	PDB:5ufuA	0.669	0.624	1.058E-20	369	0.213	0.198	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
18	PDB:3soaA	0.640	0.511	3.944E-20	436	0.233	0.183	3soaA.pdb.gz	A Mechanism for Tunable Autoinhibition in the Structure of a Human Ca(2+)/Calmodulin- Dependent Kinase II Holoenzyme.
19	PDB:4d28C	0.611	0.740	1.470E-19	279	0.239	0.294	4d28C.pdb.gz
20	PDB:4cztD	0.575	0.646	1.849E-19	302	0.230	0.262	4cztD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q28283	0.0	707	343	0.997	0.997	TRIB2_CANLF Tribbles homolog 2 OS=Canis lupus familiaris OX=9615 GN=TRIB2 PE=2 SV=1
2	Q8K4K3	0.0	700	343	0.983	0.983	TRIB2_MOUSE Tribbles homolog 2 OS=Mus musculus OX=10090 GN=Trib2 PE=2 SV=2
3	Q92519	0.0	710	343	1.000	1.000	TRIB2_HUMAN Tribbles homolog 2 OS=Homo sapiens OX=9606 GN=TRIB2 PE=1 SV=1
4	Q96RU8	3.49e-133	386	372	0.551	0.508	TRIB1_HUMAN Tribbles homolog 1 OS=Homo sapiens OX=9606 GN=TRIB1 PE=1 SV=2
5	Q8K4K4	7.24e-130	377	372	0.536	0.495	TRIB1_MOUSE Tribbles homolog 1 OS=Mus musculus OX=10090 GN=Trib1 PE=2 SV=2
6	Q6NY44	5.17e-122	357	348	0.525	0.517	Q6NY44_DANRE Tribbles homolog 3 OS=Danio rerio OX=7955 GN=zgc:76966 PE=2 SV=1
7	A0A2R8QE16	3.56e-115	339	349	0.464	0.456	A0A2R8QE16_DANRE Tribbles homolog 1 OS=Danio rerio OX=7955 GN=trib1 PE=4 SV=1
8	Q9WTQ6	2.21e-103	309	349	0.452	0.444	TRIB3_RAT Tribbles homolog 3 OS=Rattus norvegicus OX=10116 GN=Trib3 PE=2 SV=1
9	Q8K4K2	6.35e-102	306	354	0.437	0.424	TRIB3_MOUSE Tribbles homolog 3 OS=Mus musculus OX=10090 GN=Trib3 PE=1 SV=2
10	Q96RU7	1.64e-95	289	358	0.431	0.413	TRIB3_HUMAN Tribbles homolog 3 OS=Homo sapiens OX=9606 GN=TRIB3 PE=1 SV=2
11	J3KR25	2.66e-95	290	385	0.417	0.371	J3KR25_HUMAN Tribbles pseudokinase 3 OS=Homo sapiens OX=9606 GN=TRIB3 PE=1 SV=1
12	Q9V3Z1	7.73e-56	191	484	0.297	0.211	TRIB_DROME Tribbles OS=Drosophila melanogaster OX=7227 GN=trbl PE=1 SV=1
13	O74536	3.60e-34	134	576	0.251	0.149	SNF1_SCHPO SNF1-like protein kinase ssp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssp2 PE=1 SV=1
14	O22971	5.67e-34	132	502	0.259	0.177	CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana OX=3702 GN=CIPK13 PE=1 SV=2
15	F4IVM7	8.79e-34	131	451	0.248	0.188	F4IVM7_ARATH non-specific serine/threonine protein kinase OS=Arabidopsis thaliana OX=3702 GN=CIPK3 PE=1 SV=1
16	Q2V452	9.96e-34	131	441	0.248	0.193	CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana OX=3702 GN=CIPK3 PE=1 SV=2
17	Q61846	2.17e-32	129	643	0.233	0.124	MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus OX=10090 GN=Melk PE=1 SV=2
18	Q84VQ3	2.94e-32	127	439	0.257	0.200	CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana OX=3702 GN=CIPK26 PE=1 SV=2
19	Q93VD3	2.95e-32	127	482	0.236	0.168	CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana OX=3702 GN=CIPK23 PE=1 SV=1
20	A0A1D8PN61	4.78e-32	128	618	0.242	0.134	A0A1D8PN61_CANAL non-specific serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SNF1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14531 Kinase-like	0.028	25.3	Kinase-like
2	PF00069 Pkinase	5.2e-32	122.8	Protein kinase domain
3	PF07714 PK_Tyr_Ser-Thr	1.1e-14	66.0	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000155926

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000427514	0.841	CCAAT/enhancer-binding protein alpha
2	9606.ENSP00000356641	0.829	E3 ubiquitin-protein ligase RFWD2
3	9606.ENSP00000354621	0.813	E3 ubiquitin-protein ligase SMURF1
4	9606.ENSP00000359206	0.777	F-box/WD repeat-containing protein 1A
5	9606.ENSP00000483356	0.773	RIB43A domain with coiled-coils 2
6	9606.ENSP00000312150	0.699	Tribbles homolog 1
7	9606.ENSP00000303709	0.687	Ubiquitin-conjugating enzyme E2 E1
8	9606.ENSP00000254436	0.631	E3 ubiquitin-protein ligase TRIM21
9	9606.ENSP00000328327	0.621	Ankyrin repeat and SOCS box protein 7
10	9606.ENSP00000305422	0.612	CCAAT/enhancer-binding protein beta
11	9606.ENSP00000245960	0.604	M-phase inducer phosphatase 2
12	9606.ENSP00000351416	0.587	Ankyrin repeat domain-containing protein 17
13	9606.ENSP00000397261	0.546	Selenium-binding protein 1
14	9606.ENSP00000456340	0.545	DET1 homolog
15	9606.ENSP00000296953	0.543	CREB3 regulatory factor
16	9606.ENSP00000454562	0.543	Deoxyribonuclease-1-like 2
17	9606.ENSP00000362222	0.533	Serine/threonine-protein kinase 40
18	9606.ENSP00000293330	0.519	Orexin
19	9606.ENSP00000246062	0.504	McKusick-Kaufman/Bardet-Biedl syndromes putative chaperonin
20	9606.ENSP00000358983	0.503	Nuclear factor NF-kappa-B p100 subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004672	1.000	protein kinase activity
GO:0004674	0.975	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019222	0.997	regulation of metabolic process
GO:0060255	0.992	regulation of macromolecule metabolic process
GO:0048519	0.986	negative regulation of biological process
GO:0050794	0.971	regulation of cellular process
GO:0010605	0.854	negative regulation of macromolecule metabolic process
GO:0009987	0.807	cellular process
GO:0010468	0.795	regulation of gene expression
GO:0048518	0.767	positive regulation of biological process
GO:0031323	0.712	regulation of cellular metabolic process
GO:0048522	0.689	positive regulation of cellular process
GO:0080090	0.610	regulation of primary metabolic process
GO:0051171	0.540	regulation of nitrogen compound metabolic process
GO:0071704	0.491	organic substance metabolic process
GO:0009893	0.489	positive regulation of metabolic process
GO:0044238	0.480	primary metabolic process
GO:0010604	0.467	positive regulation of macromolecule metabolic process
GO:0031325	0.462	positive regulation of cellular metabolic process
GO:0050896	0.454	response to stimulus
GO:0019219	0.451	regulation of nucleobase-containing compound metabolic process
GO:0051173	0.446	positive regulation of nitrogen compound metabolic process
GO:0009889	0.437	regulation of biosynthetic process
GO:0051246	0.427	regulation of protein metabolic process
GO:0006807	0.418	nitrogen compound metabolic process
GO:0043170	0.413	macromolecule metabolic process
GO:0044237	0.411	cellular metabolic process
GO:0048523	0.394	negative regulation of cellular process
GO:0031326	0.393	regulation of cellular biosynthetic process
GO:1901564	0.374	organonitrogen compound metabolic process
GO:0019538	0.343	protein metabolic process
GO:0010556	0.323	regulation of macromolecule biosynthetic process
GO:0051252	0.318	regulation of RNA metabolic process
GO:0051716	0.308	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0031981	0.960	nuclear lumen
GO:0005654	0.943	nucleoplasm
GO:0005829	0.805	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]