StarFunc result for job id Q92521

User Input

>input (554 residues)
MRRPLSKCGMEPGGGDASLTLHGLQNRSHGKIKLRKRKSTLYFNTQEKSARRRGDLLGEN
IYLLLFTIALRILNCFLVQTSFVPDEYWQSLEVSHHMVFNYGYLTWEWTERLRSYTYPLI
FASIYKILHLLGKDSVQLLIWIPRLAQALLSAVADVRLYSLMKQLENQEVARWVFFCQLC
SWFTWYCCTRTLTNTMETVLTIIALFYYPLEGSKSMNSVKYSSLVALAFIIRPTAVILWT
PLLFRHFCQEPRKLDLILHHFLPVGFVTLSLSLMIDRIFFGQWTLVQFNFLKFNVLQNWG
TFYGSHPWHWYFSQGFPVILGTHLPFFIHGCYLAPKRYRILLVTVLWTLLVYSMLSHKEF
RFIYPVLPFCMVFCGYSLTHLKTWKKPALSFLFLSNLFLALYTGLVHQRGTLDVMSHIQK
VCYNNPNKSSASIFIMMPCHSTPYYSHVHCPLPMRFLQCPPDLTGKSHYLDEADVFYLNP
LNWLHREFHDDASLPTHLITFSILEEEISAFLISSNYKRTAVFFHTHLPEGRIGSHIYVY
ERKLKGKFNMKMKF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92521	1.000	1.000	2.575E-78	554	1.000	1.000	Q92521.pdb.gz	PIGB_HUMAN GPI mannosyltransferase 3 OS=Homo sapiens OX=9606 GN=PIGB PE=1 SV=1
2	AFDB:Q9JJQ0	0.890	0.910	1.099E-63	542	0.773	0.790	Q9JJQ0.pdb.gz	PIGB_MOUSE GPI mannosyltransferase 3 OS=Mus musculus OX=10090 GN=Pigb PE=2 SV=2
3	AFDB:Q94A15	0.833	0.841	5.066E-39	548	0.377	0.381	Q94A15.pdb.gz	APTG1_ARATH Mannosyltransferase APTG1 OS=Arabidopsis thaliana OX=3702 GN=APTG1 PE=2 SV=1
4	AFDB:Q4WPG0	0.819	0.594	2.462E-29	771	0.319	0.230	Q4WPG0.pdb.gz	GPI10_ASPFU GPI mannosyltransferase 3 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=gpi10 PE=3 SV=1
5	AFDB:Q9USN0	0.773	0.844	9.441E-29	506	0.273	0.298	Q9USN0.pdb.gz	GPI10_SCHPO GPI mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi10 PE=3 SV=1
6	AFDB:P86935	0.784	0.779	8.104E-27	558	0.255	0.253	P86935.pdb.gz	GPI10_TRYBB GPI mannosyltransferase 3 OS=Trypanosoma brucei brucei OX=5702 GN=GPI10 PE=2 SV=1
7	AFDB:P30777	0.788	0.712	1.296E-25	616	0.285	0.256	P30777.pdb.gz	GPI10_YEAST GPI mannosyltransferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI10 PE=1 SV=2
8	AFDB:Q8IDS3	0.743	0.533	1.004E-20	786	0.251	0.177	Q8IDS3.pdb.gz	Q8IDS3_PLAF7 Mannosyltransferase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1341600 PE=3 SV=1
9	AFDB:Q9BV10	0.639	0.717	3.526E-15	488	0.168	0.191	Q9BV10.pdb.gz	ALG12_HUMAN Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG12 PE=1 SV=1
10	AFDB:Q54WW9	0.685	0.594	3.999E-15	649	0.193	0.165	Q54WW9.pdb.gz	Q54WW9_DICDI Mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg9 PE=3 SV=1
11	PDB:6s7oA	0.487	0.424	2.605E-4	656	0.116	0.098	6s7oA.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.
12	PDB:6eznF	0.459	0.404	3.965E-4	650	0.099	0.085	6eznF.pdb.gz	Molecular basis for glycan recognition and reaction priming of eukaryotic oligosaccharyltransferase.
13	PDB:5oglA	0.430	0.352	1.133E-3	707	0.112	0.088	5oglA.pdb.gz	Molecular basis of lipid-linked oligosaccharide recognition and processing by bacterial oligosaccharyltransferase.
14	PDB:6s7tA	0.448	0.368	2.040E-3	706	0.105	0.082	6s7tA.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.
15	PDB:6p25B	0.313	0.256	1.409E-2	690	0.052	0.042	6p25B.pdb.gz	Structure of the eukaryotic protein O-mannosyltransferase Pmt1-Pmt2 complex.
16	PDB:7w72U	0.308	0.388	1.890E-2	420	0.090	0.119	7w72U.pdb.gz	Structure of human glycosylphosphatidylinositol transamidase.
17	PDB:7bvfB	0.365	0.210	4.379E-2	1054	0.101	0.053	7bvfB.pdb.gz	Structures of cell wall arabinosyltransferases with the anti-tuberculosis drug ethambutol.
18	PDB:7bvfA	0.274	0.158	8.942E-2	1087	0.103	0.052	7bvfA.pdb.gz	Structures of cell wall arabinosyltransferases with the anti-tuberculosis drug ethambutol.
19	PDB:6p25A	0.304	0.238	1.419E-1	731	0.067	0.051	6p25A.pdb.gz	Structure of the eukaryotic protein O-mannosyltransferase Pmt1-Pmt2 complex.
20	PDB:6snhX	0.316	0.354	1.986E-1	479	0.114	0.132	6snhX.pdb.gz	Structure and mechanism of the ER-based glucosyltransferase ALG6.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q92521	0.0	1143	554	1.000	1.000	PIGB_HUMAN GPI mannosyltransferase 3 OS=Homo sapiens OX=9606 GN=PIGB PE=1 SV=1
2	Q9JJQ0	0.0	874	542	0.780	0.797	PIGB_MOUSE GPI mannosyltransferase 3 OS=Mus musculus OX=10090 GN=Pigb PE=2 SV=2
3	Q94A15	1.12e-128	389	548	0.368	0.372	APTG1_ARATH Mannosyltransferase APTG1 OS=Arabidopsis thaliana OX=3702 GN=APTG1 PE=2 SV=1
4	Q4WPG0	3.82e-69	239	771	0.332	0.239	GPI10_ASPFU GPI mannosyltransferase 3 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=gpi10 PE=3 SV=1
5	Q9USN0	3.98e-68	230	506	0.298	0.326	GPI10_SCHPO GPI mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi10 PE=3 SV=1
6	P30777	1.46e-53	194	616	0.287	0.258	GPI10_YEAST GPI mannosyltransferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI10 PE=1 SV=2
7	P86935	2.51e-50	184	558	0.235	0.233	GPI10_TRYBB GPI mannosyltransferase 3 OS=Trypanosoma brucei brucei OX=5702 GN=GPI10 PE=2 SV=1
8	P86936	3.46e-48	177	558	0.231	0.229	GPI10_TRYB2 GPI mannosyltransferase 3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=GPI10 PE=3 SV=1
9	Q8IDS3	2.90e-15	81.3	786	0.074	0.052	Q8IDS3_PLAF7 Mannosyltransferase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1341600 PE=3 SV=1
10	Q54WW9	3.48e-13	74.7	649	0.161	0.137	Q54WW9_DICDI Mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg9 PE=3 SV=1
11	A8MR93	4.64e-10	64.3	497	0.128	0.143	ALG12_ARATH Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Arabidopsis thaliana OX=3702 GN=ALG12 PE=1 SV=1
12	Q9BV10	7.18e-10	63.9	488	0.085	0.096	ALG12_HUMAN Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG12 PE=1 SV=1
13	Q09837	4.21e-08	58.2	533	0.171	0.178	SMP3_SCHPO GPI mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=smp3 PE=3 SV=1
14	P53730	4.27e-07	55.1	551	0.101	0.102	ALG12_YEAST Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG12 PE=1 SV=1
15	Q9P7Q9	5.35e-07	54.7	577	0.125	0.120	ALG9_SCHPO Alpha-1,2-mannosyltransferase alg9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg9 PE=3 SV=1
16	Q9VBV8	1.23e-06	53.5	623	0.139	0.124	Q9VBV8_DROME Mannosyltransferase OS=Drosophila melanogaster OX=7227 GN=Alg9 PE=2 SV=1
17	Q9H6U8	1.88e-06	53.1	611	0.123	0.111	ALG9_HUMAN Alpha-1,2-mannosyltransferase ALG9 OS=Homo sapiens OX=9606 GN=ALG9 PE=1 SV=2
18	B4DYW0	2.23e-06	53.1	844	0.123	0.081	B4DYW0_HUMAN Mannosyltransferase OS=Homo sapiens OX=9606 PE=2 SV=1
19	Q04174	1.31e-05	50.4	516	0.135	0.145	SMP3_YEAST GPI mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMP3 PE=1 SV=3
20	Q9USD4	1.87e-05	49.7	546	0.054	0.055	ALG12_SCHPO Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg12 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03901 Glyco_transf_22	1.5e-120	414.9	Alg9-like mannosyltransferase family
2	PF13231 PMT_2	2.3	19.9	Dolichyl-phosphate-mannose-protein mannosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000164305

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357069	0.991	GPI mannosyltransferase 1
2	9606.ENSP00000363260	0.990	GPI mannosyltransferase 2
3	9606.ENSP00000367880	0.989	GPI ethanolamine phosphate transferase 3
4	9606.ENSP00000350263	0.985	GPI ethanolamine phosphate transferase 1
5	9606.ENSP00000281382	0.963	Phosphatidylinositol-glycan biosynthesis class F protein
6	9606.ENSP00000360644	0.943	Dolichol-phosphate mannosyltransferase subunit 1
7	9606.ENSP00000380793	0.915	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
8	9606.ENSP00000322181	0.909	Dolichol phosphate-mannose biosynthesis regulatory protein
9	9606.ENSP00000356702	0.903	Phosphatidylinositol N-acetylglucosaminyltransferase subunit C
10	9606.ENSP00000369820	0.884	Phosphatidylinositol N-acetylglucosaminyltransferase subunit A
11	9606.ENSP00000357384	0.883	Dolichol-phosphate mannosyltransferase subunit 3
12	9606.ENSP00000359848	0.873	GPI-anchor transamidase
13	9606.ENSP00000225609	0.868	N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
14	9606.ENSP00000415203	0.862	GPI ethanolamine phosphate transferase 2
15	9606.ENSP00000347206	0.860	Glycosylphosphatidylinositol anchor attachment 1 protein
16	9606.ENSP00000420037	0.851	Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
17	9606.ENSP00000026218	0.830	Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q
18	9606.ENSP00000482202	0.828	Phosphatidylinositol-glycan biosynthesis class W protein
19	9606.ENSP00000346809	0.818	GPI inositol-deacylase
20	9606.ENSP00000279036	0.816	GPI transamidase component PIG-T

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000030	1.000	mannosyltransferase activity
GO:0004376	0.806	glycolipid mannosyltransferase activity
GO:0005488	0.487	binding
GO:0005515	0.384	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:0008610	0.995	lipid biosynthetic process
GO:0036211	0.992	protein modification process
GO:1901137	0.991	carbohydrate derivative biosynthetic process
GO:1901566	0.991	organonitrogen compound biosynthetic process
GO:0034645	0.991	cellular macromolecule biosynthetic process
GO:0046467	0.990	membrane lipid biosynthetic process
GO:0046474	0.987	glycerophospholipid biosynthetic process
GO:0006664	0.985	glycolipid metabolic process
GO:0006506	0.984	GPI anchor biosynthetic process
GO:0070085	0.946	glycosylation
GO:0097502	0.851	mannosylation
GO:0016254	0.328	preassembly of GPI anchor in ER membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]