StarFunc result for job id Q92523

User Input

>input (772 residues)
MAEAHQAVAFQFTVTPDGVDFRLSREALKHVYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLVVIMATVGSSFCNVDISLGLVSCIQRCLPQGCGPYQTPQTRALLSMAIFSTGVWVTG
IFFFRQTLKLLLCYHGWMFEMHGKTSNLTRIWAMCIRLLSSRHPMLYSFQTSLPKLPVPR
VSATIQRYLESVRPLLDDEEYYRMELLAKEFQDKTAPRLQKYLVLKSWWASNYVSDWWEE
YIYLRGRSPLMVNSNYYVMDLVLIKNTDVQAARLGNIIHAMIMYRRKLDREEIKPVMALG
IVPMCSYQMERMFNTTRIPGKDTDVLQHLSDSRHVAVYHKGRFFKLWLYEGARLLKPQDL
EMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVA
LDEESYSYDPEDEASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNAEHAWADAPI
IGHLWEFVLGTDSFHLGYTETGHCLGKPNPALAPPTRLQWDIPKQCQAVIESSYQVAKAL
ADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFREG
RTETVRSCTSESTAFVQAMMEGSHTKADLRDLFQKAAKKHQNMYRLAMTGAGIDRHLFCL
YLVSKYLGVSSPFLAEVLSEPWRLSTSQIPQSQIRMFDPEQHPNHLGAGGGFGPVADDGY
GVSYMIAGENTIFFHISSKFSSSETNAQRFGNHIRKALLDIADLFQVPKAYS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R5F4	0.987	0.986	0.000	773	0.628	0.627	A0A024R5F4.pdb.gz
2	AFDB:A0A1L1U0X8	0.977	0.974	0.000	774	0.609	0.607	A0A1L1U0X8.pdb.gz
3	AFDB:E9QI17	0.987	0.983	0.000	775	0.626	0.623	E9QI17.pdb.gz	E9QI17_DANRE carnitine O-palmitoyltransferase OS=Danio rerio OX=7955 GN=cpt1ab PE=1 SV=2
4	AFDB:F6P7Z9	0.979	0.982	0.000	770	0.642	0.644	F6P7Z9.pdb.gz	F6P7Z9_DANRE carnitine O-palmitoyltransferase OS=Danio rerio OX=7955 GN=cpt1al PE=3 SV=2
5	AFDB:P32198	0.987	0.985	0.000	773	0.628	0.627	P32198.pdb.gz	CPT1A_RAT Carnitine O-palmitoyltransferase 1, liver isoform OS=Rattus norvegicus OX=10116 GN=Cpt1a PE=1 SV=2
6	AFDB:Q2UZM8	0.981	0.979	0.000	773	0.609	0.608	Q2UZM8.pdb.gz	Q2UZM8_ONCMY carnitine O-palmitoyltransferase OS=Oncorhynchus mykiss OX=8022 GN=cpt1 PE=2 SV=1
7	AFDB:Q63704	0.990	0.990	0.000	772	0.860	0.860	Q63704.pdb.gz	CPT1B_RAT Carnitine O-palmitoyltransferase 1, muscle isoform OS=Rattus norvegicus OX=10116 GN=Cpt1b PE=1 SV=1
8	AFDB:Q8AYL4	0.922	0.949	0.000	750	0.642	0.661	Q8AYL4.pdb.gz	Q8AYL4_ONCMY carnitine O-palmitoyltransferase OS=Oncorhynchus mykiss OX=8022 GN=CPT1 PE=2 SV=2
9	AFDB:Q92523	1.000	1.000	0.000	772	1.000	1.000	Q92523.pdb.gz	CPT1B_HUMAN Carnitine O-palmitoyltransferase 1, muscle isoform OS=Homo sapiens OX=9606 GN=CPT1B PE=1 SV=2
10	AFDB:Q8TCG5	0.959	0.923	1.331E-102	803	0.527	0.507	Q8TCG5.pdb.gz	CPT1C_HUMAN Carnitine O-palmitoyltransferase 1, brain isoform OS=Homo sapiens OX=9606 GN=CPT1C PE=1 SV=1
11	PDB:2h3pA	0.708	0.906	6.093E-53	599	0.238	0.307	2h3pA.pdb.gz	Crystal structures of murine carnitine acetyltransferase in ternary complexes with its substrates
12	PDB:1xl8B	0.705	0.901	7.451E-50	600	0.227	0.292	1xl8B.pdb.gz	Crystal structure of mouse carnitine octanoyltransferase and molecular determinants of substrate selectivity.
13	PDB:1q6xA	0.688	0.878	2.960E-49	600	0.231	0.297	1q6xA.pdb.gz
14	PDB:4eywB	0.706	0.855	1.501E-47	634	0.222	0.270	4eywB.pdb.gz	Isothermal titration calorimetry with micelles: Thermodynamics of inhibitor binding to carnitine palmitoyltransferase 2 membrane protein.
15	PDB:6lpwB	0.200	0.315	1.867E-5	436	0.048	0.085	6lpwB.pdb.gz	Structural and Biochemical Insights Into Two BAHD Acyltransferases ( At SHT and At SDT) Involved in Phenolamide Biosynthesis.
16	PDB:1l5aA	0.213	0.339	1.075E-4	424	0.048	0.087	1l5aA.pdb.gz
17	PDB:2xr7A	0.201	0.299	3.275E-4	452	0.048	0.082	2xr7A.pdb.gz	Structural Basis for Modification of Flavonol and Naphthol Glucoconjugates by Nicotiana Tabacum Malonyltransferase (Ntmat1).
18	PDB:7cysA	0.233	0.364	3.840E-4	431	0.069	0.123	7cysA.pdb.gz
19	PDB:6lpvA	0.173	0.268	6.190E-4	434	0.054	0.097	6lpvA.pdb.gz	Structural and Biochemical Insights Into Two BAHD Acyltransferases ( At SHT and At SDT) Involved in Phenolamide Biosynthesis.
20	PDB:5kjtA	0.213	0.341	7.654E-4	431	0.065	0.116	5kjtA.pdb.gz	Dynamic Conformational States Dictate Selectivity toward the Native Substrate in a Substrate-Permissive Acyltransferase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RRE8	0.0	1182	567	0.733	0.998	A2RRE8_HUMAN CPT1B protein OS=Homo sapiens OX=9606 GN=CPT1B PE=1 SV=1
2	E9QI17	0.0	1033	775	0.627	0.625	E9QI17_DANRE carnitine O-palmitoyltransferase OS=Danio rerio OX=7955 GN=cpt1ab PE=1 SV=2
3	F1LN46	0.0	808	801	0.514	0.496	CPT1C_RAT Carnitine O-palmitoyltransferase 1, brain isoform OS=Rattus norvegicus OX=10116 GN=Cpt1c PE=1 SV=1
4	F6P7Z9	0.0	1072	770	0.644	0.645	F6P7Z9_DANRE carnitine O-palmitoyltransferase OS=Danio rerio OX=7955 GN=cpt1al PE=3 SV=2
5	K7DY29	0.0	1045	774	0.627	0.625	K7DY29_DANRE carnitine O-palmitoyltransferase OS=Danio rerio OX=7955 GN=cpt1ab PE=1 SV=1
6	P32198	0.0	1050	773	0.630	0.629	CPT1A_RAT Carnitine O-palmitoyltransferase 1, liver isoform OS=Rattus norvegicus OX=10116 GN=Cpt1a PE=1 SV=2
7	P50416	0.0	1057	773	0.630	0.629	CPT1A_HUMAN Carnitine O-palmitoyltransferase 1, liver isoform OS=Homo sapiens OX=9606 GN=CPT1A PE=1 SV=2
8	P97742	0.0	1050	773	0.627	0.626	CPT1A_MOUSE Carnitine O-palmitoyltransferase 1, liver isoform OS=Mus musculus OX=10090 GN=Cpt1a PE=1 SV=4
9	Q1MTA9	0.0	984	773	0.610	0.609	Q1MTA9_DANRE carnitine O-palmitoyltransferase OS=Danio rerio OX=7955 GN=cpt1a PE=1 SV=2
10	Q2UZM8	0.0	986	773	0.611	0.611	Q2UZM8_ONCMY carnitine O-palmitoyltransferase OS=Oncorhynchus mykiss OX=8022 GN=cpt1 PE=2 SV=1
11	Q63704	0.0	1420	772	0.860	0.860	CPT1B_RAT Carnitine O-palmitoyltransferase 1, muscle isoform OS=Rattus norvegicus OX=10116 GN=Cpt1b PE=1 SV=1
12	Q7JQH9	0.0	797	780	0.518	0.513	Q7JQH9_DROME carnitine O-palmitoyltransferase OS=Drosophila melanogaster OX=7227 GN=whd PE=1 SV=1
13	Q8AYL4	0.0	1049	750	0.642	0.661	Q8AYL4_ONCMY carnitine O-palmitoyltransferase OS=Oncorhynchus mykiss OX=8022 GN=CPT1 PE=2 SV=2
14	Q8BGD5	0.0	799	798	0.510	0.494	CPT1C_MOUSE Carnitine O-palmitoyltransferase 1, brain isoform OS=Mus musculus OX=10090 GN=Cpt1c PE=1 SV=1
15	Q8TCG5	0.0	845	803	0.530	0.509	CPT1C_HUMAN Carnitine O-palmitoyltransferase 1, brain isoform OS=Homo sapiens OX=9606 GN=CPT1C PE=1 SV=1
16	Q924X2	0.0	1439	772	0.870	0.870	CPT1B_MOUSE Carnitine O-palmitoyltransferase 1, muscle isoform OS=Mus musculus OX=10090 GN=Cpt1b PE=1 SV=1
17	Q92523	0.0	1618	772	1.000	1.000	CPT1B_HUMAN Carnitine O-palmitoyltransferase 1, muscle isoform OS=Homo sapiens OX=9606 GN=CPT1B PE=1 SV=2
18	Q9V3K9	0.0	785	782	0.513	0.506	Q9V3K9_DROME carnitine O-palmitoyltransferase OS=Drosophila melanogaster OX=7227 GN=whd PE=1 SV=1
19	P43155	1.38e-87	291	626	0.263	0.324	CACP_HUMAN Carnitine O-acetyltransferase OS=Homo sapiens OX=9606 GN=CRAT PE=1 SV=5
20	P47934	1.32e-84	283	626	0.256	0.316	CACP_MOUSE Carnitine O-acetyltransferase OS=Mus musculus OX=10090 GN=Crat PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00755 Carn_acyltransf	2.4e-192	652.2	Choline/Carnitine o-acyltransferase
2	PF16484 CPT_N	4.7e-22	89.0	Carnitine O-palmitoyltransferase N-terminus
3	PF11326 DUF3128	1.1e+02	14.6	Protein of unknown function (DUF3128)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379011

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326305	0.988	Mitochondrial carnitine/acylcarnitine carrier protein
2	9606.ENSP00000360541	0.934	Carnitine O-palmitoyltransferase 2, mitochondrial
3	9606.ENSP00000384400	0.929	Choline/ethanolamine kinase
4	9606.ENSP00000341044	0.920	Acetyl-CoA carboxylase 2
5	9606.ENSP00000328551	0.844	Ras-related protein Rab-28
6	9606.ENSP00000422607	0.839	Long-chain-fatty-acid--CoA ligase 1
7	9606.ENSP00000376303	0.809	Carnitine O-palmitoyltransferase 1, brain isoform
8	9606.ENSP00000265641	0.807	Carnitine O-palmitoyltransferase 1, liver isoform
9	9606.ENSP00000350012	0.781	Long-chain-fatty-acid--CoA ligase 3
10	9606.ENSP00000348429	0.767	Long-chain-fatty-acid--CoA ligase 5
11	9606.ENSP00000339787	0.757	Long-chain-fatty-acid--CoA ligase 4
12	9606.ENSP00000005178	0.742	[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial
13	9606.ENSP00000385523	0.732	Peroxisome proliferator-activated receptor alpha
14	9606.ENSP00000465589	0.729	Long-chain-fatty-acid--CoA ligase ACSBG2
15	9606.ENSP00000323740	0.725	Mitochondrial uncoupling protein 3
16	9606.ENSP00000366915	0.725	Krueppel-like factor 5
17	9606.ENSP00000368566	0.721	Long-chain-fatty-acid--CoA ligase 6
18	9606.ENSP00000264867	0.715	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
19	9606.ENSP00000262999	0.706	Mitochondrial brown fat uncoupling protein 1
20	9606.ENSP00000359871	0.702	Medium-chain specific acyl-CoA dehydrogenase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004095	1.000	carnitine O-palmitoyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.983	organic substance metabolic process
GO:0044237	0.982	cellular metabolic process
GO:0015908	0.982	fatty acid transport
GO:0044238	0.981	primary metabolic process
GO:0015909	0.961	long-chain fatty acid transport
GO:0006631	0.916	fatty acid metabolic process
GO:0030258	0.913	lipid modification
GO:0019395	0.878	fatty acid oxidation
GO:0044242	0.873	cellular lipid catabolic process
GO:0046395	0.860	carboxylic acid catabolic process
GO:0009062	0.839	fatty acid catabolic process
GO:0006635	0.776	fatty acid beta-oxidation
GO:1905039	0.647	carboxylic acid transmembrane transport
GO:0032365	0.625	intracellular lipid transport
GO:0065007	0.485	biological regulation
GO:1990542	0.474	mitochondrial transmembrane transport
GO:0006807	0.423	nitrogen compound metabolic process
GO:0050789	0.331	regulation of biological process
GO:0050794	0.305	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005739	1.000	mitochondrion
GO:0031090	0.991	organelle membrane
GO:0031966	0.939	mitochondrial membrane
GO:0098588	0.899	bounding membrane of organelle
GO:0019867	0.828	outer membrane
GO:0005741	0.801	mitochondrial outer membrane
GO:0012505	0.725	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12661	1.000	(R)-carnitine + hexadecanoyl-CoA = CoA + O-hexadecanoyl-(R)-carnitine
EC:2.3.1.21	1.000	carnitine O-palmitoyltransferase.

[back to server]