StarFunc result for job id Q92535

User Input

>input (297 residues)
MYAQPVTNTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFESSVVIQ
QLCSVCVFVVIWWYMDEGLLAPHWLLGTGLASSLIGYVLFDLIDGGEGRKKSGQTRWADL
KSALVFITFTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLN
MAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKLKACTPRSYVGVTLLFAFSAV
GGLLSISAVGAVLFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92535	1.000	1.000	2.517E-41	297	1.000	1.000	Q92535.pdb.gz	PIGC_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Homo sapiens OX=9606 GN=PIGC PE=1 SV=1
2	AFDB:O59802	0.838	0.770	9.272E-18	324	0.306	0.281	O59802.pdb.gz	GPI2_SCHPO Phosphatidylinositol N-acetylglucosaminyltransferase GPI2 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi2 PE=3 SV=1
3	AFDB:O64761	0.854	0.837	1.116E-17	303	0.300	0.294	O64761.pdb.gz	PIGC_ARATH Phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Arabidopsis thaliana OX=3702 GN=PIGC PE=2 SV=1
4	AFDB:Q9VZR1	0.760	0.787	1.618E-17	286	0.357	0.371	Q9VZR1.pdb.gz	Q9VZR1_DROME Phosphatidylinositol glycan anchor biosynthesis class C, isoform B OS=Drosophila melanogaster OX=7227 GN=PIG-C PE=3 SV=3
5	AFDB:Q38AZ2	0.811	0.713	8.998E-17	342	0.293	0.254	Q38AZ2.pdb.gz	Q38AZ2_TRYB2 PhosphatidylinositolN-acetylglucosaminyltransferase subunit c, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0720 PE=3 SV=1
6	AFDB:O01259	0.776	0.813	2.172E-16	282	0.266	0.280	O01259.pdb.gz	O01259_CAEEL Phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Caenorhabditis elegans OX=6239 GN=pigc-1 PE=3 SV=2
7	AFDB:Q5A6L6	0.780	0.764	3.618E-16	304	0.269	0.263	Q5A6L6.pdb.gz	Q5A6L6_CANAL Phosphatidylinositol N-acetylglucosaminyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI2 PE=3 SV=1
8	AFDB:P46961	0.649	0.686	1.658E-7	280	0.182	0.193	P46961.pdb.gz	GPI2_YEAST Phosphatidylinositol N-acetylglucosaminyltransferase GPI2 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI2 PE=1 SV=2
9	AFDB:Q8R139	0.183	0.123	1.591E-1	528	0.101	0.057	Q8R139.pdb.gz	S29A4_MOUSE Equilibrative nucleoside transporter 4 OS=Mus musculus OX=10090 GN=Slc29a4 PE=1 SV=1
10	AFDB:Q5PP33	0.169	0.117	1.667E-1	505	0.158	0.093	Q5PP33.pdb.gz	Q5PP33_ARATH At5g19500 OS=Arabidopsis thaliana OX=3702 GN=At5g19500 PE=1 SV=1
11	PDB:1qz4A	0.156	0.195	8.614E-1	213	0.108	0.150	1qz4A.pdb.gz
12	PDB:7n98A	0.159	0.115	9.023E-1	473	0.121	0.076	7n98A.pdb.gz
13	PDB:7p9uB	0.149	0.107	9.451E-1	455	0.098	0.064	7p9uB.pdb.gz	Molecular basis for redox control by the human cystine/glutamate antiporter system xc .
14	PDB:7wsmA	0.149	0.111	1.037	464	0.125	0.080	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
15	PDB:4yzfA	0.118	0.092	1.086	475	0.145	0.091	4yzfA.pdb.gz	Crystal structure of the anion exchanger domain of human erythrocyte band 3.
16	PDB:6qpiA	0.119	0.141	1.192	231	0.098	0.126	6qpiA.pdb.gz
17	PDB:5j4nA	0.146	0.107	1.248	437	0.108	0.073	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
18	PDB:6li9B	0.168	0.118	1.248	458	0.104	0.068	6li9B.pdb.gz	Cryo-EM structure of the human heteromeric amino acid transporter b0,+AT-rBAT.
19	PDB:4atvA	0.145	0.122	1.435	381	0.141	0.110	4atvA.pdb.gz
20	PDB:2wsxA	0.162	0.112	1.503	496	0.138	0.083	2wsxA.pdb.gz	Structural Basis of Na(+)-Independent and Cooperative Substrate/Product Antiport in Cait.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q92535	0.0	610	297	1.000	1.000	PIGC_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Homo sapiens OX=9606 GN=PIGC PE=1 SV=1
2	Q9VZR1	5.20e-56	184	286	0.360	0.374	Q9VZR1_DROME Phosphatidylinositol glycan anchor biosynthesis class C, isoform B OS=Drosophila melanogaster OX=7227 GN=PIG-C PE=3 SV=3
3	O59802	4.87e-44	154	324	0.300	0.275	GPI2_SCHPO Phosphatidylinositol N-acetylglucosaminyltransferase GPI2 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi2 PE=3 SV=1
4	O01259	5.26e-35	129	282	0.306	0.323	O01259_CAEEL Phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Caenorhabditis elegans OX=6239 GN=pigc-1 PE=3 SV=2
5	Q5A6L6	2.72e-32	123	304	0.306	0.299	Q5A6L6_CANAL Phosphatidylinositol N-acetylglucosaminyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI2 PE=3 SV=1
6	Q38AZ2	6.06e-32	123	342	0.290	0.251	Q38AZ2_TRYB2 PhosphatidylinositolN-acetylglucosaminyltransferase subunit c, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0720 PE=3 SV=1
7	O64761	2.67e-30	117	303	0.330	0.323	PIGC_ARATH Phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Arabidopsis thaliana OX=3702 GN=PIGC PE=2 SV=1
8	P46961	4.75e-06	49.3	280	0.168	0.179	GPI2_YEAST Phosphatidylinositol N-acetylglucosaminyltransferase GPI2 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI2 PE=1 SV=2
9	Q7M717	2.4	32.0	329	0.084	0.076	TR102_MOUSE Taste receptor type 2 member 102 OS=Mus musculus OX=10090 GN=Tas2r102 PE=3 SV=1
10	Q59K07	3.0	32.0	369	0.044	0.035	EAF3_CANAL Chromatin modification-related protein EAF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EAF3 PE=3 SV=1
11	Q7Z628	4.4	31.6	596	0.091	0.045	ARHG8_HUMAN Neuroepithelial cell-transforming gene 1 protein OS=Homo sapiens OX=9606 GN=NET1 PE=1 SV=1
12	Q9Z206	5.7	31.2	595	0.091	0.045	ARHG8_MOUSE Neuroepithelial cell-transforming gene 1 protein OS=Mus musculus OX=10090 GN=Net1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06432 GPI2	4.8e-85	297.0	Phosphatidylinositol N-acetylglucosaminyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356702

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216452	0.999	Phosphatidylinositol N-acetylglucosaminyltransferase subunit H
2	9606.ENSP00000026218	0.998	Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q
3	9606.ENSP00000369820	0.998	Phosphatidylinositol N-acetylglucosaminyltransferase subunit A
4	9606.ENSP00000420037	0.994	Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
5	9606.ENSP00000225609	0.988	N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
6	9606.ENSP00000322181	0.988	Dolichol phosphate-mannose biosynthesis regulatory protein
7	9606.ENSP00000432688	0.975	Phosphatidylinositol N-acetylglucosaminyltransferase subunit Y
8	9606.ENSP00000273968	0.932	Protein preY, mitochondrial
9	9606.ENSP00000164305	0.903	GPI mannosyltransferase 3
10	9606.ENSP00000357069	0.885	GPI mannosyltransferase 1
11	9606.ENSP00000219789	0.842	CDP-diacylglycerol--inositol 3-phosphatidyltransferase
12	9606.ENSP00000359848	0.832	GPI-anchor transamidase
13	9606.ENSP00000415203	0.828	GPI ethanolamine phosphate transferase 2
14	9606.ENSP00000363260	0.809	GPI mannosyltransferase 2
15	9606.ENSP00000279036	0.805	GPI transamidase component PIG-T
16	9606.ENSP00000347206	0.799	Glycosylphosphatidylinositol anchor attachment 1 protein
17	9606.ENSP00000371307	0.788	Phospholipid phosphatase 6
18	9606.ENSP00000346809	0.771	GPI inositol-deacylase
19	9606.ENSP00000482202	0.729	Phosphatidylinositol-glycan biosynthesis class W protein
20	9606.ENSP00000343629	0.726	Protein PRRC2C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003824	0.999	catalytic activity
GO:0005515	0.999	protein binding
GO:0016740	0.330	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0036211	0.985	protein modification process
GO:1901576	0.969	organic substance biosynthetic process
GO:0044249	0.962	cellular biosynthetic process
GO:0009059	0.962	macromolecule biosynthetic process
GO:1901135	0.960	carbohydrate derivative metabolic process
GO:1901566	0.959	organonitrogen compound biosynthetic process
GO:0044260	0.956	cellular macromolecule metabolic process
GO:0046488	0.955	phosphatidylinositol metabolic process
GO:0006506	0.952	GPI anchor biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane
GO:1902494	0.998	catalytic complex
GO:0098796	0.997	membrane protein complex
GO:0140534	0.996	endoplasmic reticulum protein-containing complex
GO:1990234	0.993	transferase complex
GO:0000506	0.584	glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.330	Transferases.

[back to server]