StarFunc result for job id Q92538

User Input

>input (1859 residues)
MVDKNIYIIQGEINIVVGAIKRNARWSTHTPLDEERDPLLHSFGHLKEVLNSITELSEIE
PNVFLRPFLEVIRSEDTTGPITGLALTSVNKFLSYALIDPTHEGTAEGMENMADAVTHAR
FVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKS
AEHTLVDMVQLLFTRLPQFKEEPKNYVGTNMKKLKMRAGGMSDSSKWKKQKRSPRPPRHM
TKVTPGSELPTPNGTTLSSNLTGGMPFIDVPTPISSASSEAASAVVSPSTDSGLEFSSQT
TSKEDLTDLEQPGSPGYSTATEPGSSELGVPEQPDLQEGTHVEKSQSASVESIPEVLEEC
TSPADHSDSASVHDMDYVNPRGVRFTQSSQKEGTALVPYGLPCIRELFRFLISLTNPHDR
HNSEVMIHMGLHLLTVALESAPVAQCQTLLGLIKDEMCRHLFQLLSIERLNLYAASLRVC
FLLFESMREHLKFQMEMYIKKLMEIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYI
NYDCDYYCSNLFEELTKLLSKNAFPVSGQLYTTHLLSLDALLTVIDSTEAHCQAKVLNSL
TQQEKKETARPSCEIVDGTREASNTERTASDGKAVGMASDIPGLHLPGGGRLPPEHGKSG
CSDLEEAVDSGADKKFARKPPRFSCLLPDPRELIEIKNKKKLLITGTEQFNQKPKKGIQF
LQEKGLLTIPMDNTEVAQWLRENPRLDKKMIGEFVSDRKNIDLLESFVSTFSFQGLRLDE
ALRLYLEAFRLPGEAPVIQRLLEAFTERWMNCNGSPFANSDACFSLAYAVIMLNTDQHNH
NVRKQNAPMTLEEFRKNLKGVNGGKDFEQDILEDMYHAIKNEEIVMPEEQTGLVRENYVW
NVLLHRGATPEGIFLRVPTASYDLDLFTMTWGPTIAALSYVFDKSLEETIIQKAISGFRK
CAMISAHYGLSDVFDNLIISLCKFTALSSESIENLPSVFGSNPKAHIAAKTVFHLAHRHG
DILREGWKNIMEAMLQLFRAQLLPKAMIEVEDFVDPNGKISLQREETPSNRGESTVLSFV
SWLTLSGPEQSSVRGPSTENQEAKRVALECIKQCDPEKMITESKFLQLESLQELMKALVS
VTPDEETYDEEDAAFCLEMLLRIVLENRDRVGCVWQTVRDHLYHLCVQAQDFCFLVERAV
VGLLRLAIRLLRREEISAQVLLSLRILLLMKPSVLSRVSHQVAYGLHELLKTNAANIHSG
DDWATLFTLLECIGSGVKPPAALQATARADAPDAGAQSDSELPSYHQNDVSLDRGYTSDS
EVYTDHGRPGKIHRSATDADVVNSGWLVVGKDDVDNSKPGPSRPGPSPLINQYSLTVGLD
LGPHDTKSLLKCVESLSFIVRDAAHITPDNFELCVKTLRIFVEASLNGGCKSQEKRGKSH
KYDSKGNRFKKKSKEGSMLRRPRTSSQHASRGGQSDDDEDEGVPASYHTVSLQVSQDLLD
LMHTLHTRAASIYSSWAEEQRHLETGGQKIEADSRTLWAHCWCPLLQGIACLCCDARRQV
RMQALTYLQRALLVHDLQKLDALEWESCFNKVLFPLLTKLLENISPADVGGMEETRMRAS
TLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHAGSSDLLSEAIPESLKNMLLVMDT
AEIFHSADARGGGPSALWEITWERIDCFLPHLRDELFKQTVIQDPMPMEPQGQKPLASAH
LTSAAGDTRTPGHPPPPEIPSELGACDFEKPESPRAASSSSPGSPVASSPSRLSPTPDGP
PPLAQPPLILQPLASPLQVGVPPMTLPIILNPALIEATSPVPLLATPRPTDPIPTSEVN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6DFZ1	0.772	0.772	0.000	1861	0.940	0.939	Q6DFZ1.pdb.gz	Q6DFZ1_MOUSE Golgi-specific brefeldin A-resistance factor 1 OS=Mus musculus OX=10090 GN=Gbf1 PE=1 SV=1
2	AFDB:A1Z8W8	0.693	0.652	6.308E-100	1983	0.433	0.406	A1Z8W8.pdb.gz	A1Z8W8_DROME Gartenzwerg, isoform B OS=Drosophila melanogaster OX=7227 GN=garz PE=1 SV=1
3	AFDB:Q42510	0.564	0.706	1.388E-63	1451	0.265	0.340	Q42510.pdb.gz	GNOM_ARATH ARF guanine-nucleotide exchange factor GNOM OS=Arabidopsis thaliana OX=3702 GN=GN PE=1 SV=1
4	AFDB:Q9FLY5	0.584	0.740	4.778E-61	1443	0.248	0.319	Q9FLY5.pdb.gz	GNL1_ARATH ARF guanine-nucleotide exchange factor GNL1 OS=Arabidopsis thaliana OX=3702 GN=GNL1 PE=3 SV=1
5	AFDB:Q9P7R8	0.533	0.660	6.070E-49	1462	0.189	0.240	Q9P7R8.pdb.gz	YHV3_SCHPO Uncharacterized protein C211.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC211.03c PE=1 SV=1
6	AFDB:P39993	0.512	0.635	9.109E-41	1459	0.181	0.230	P39993.pdb.gz	GEA2_YEAST ARF guanine-nucleotide exchange factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GEA2 PE=1 SV=1
7	AFDB:E7FCG1	0.436	0.439	1.657E-40	1846	0.179	0.180	E7FCG1.pdb.gz	E7FCG1_DANRE ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited) OS=Danio rerio OX=7955 GN=arfgef2 PE=1 SV=1
8	AFDB:P47102	0.476	0.609	3.417E-39	1408	0.169	0.223	P47102.pdb.gz	GEA1_YEAST ARF guanine-nucleotide exchange factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GEA1 PE=1 SV=1
9	PDB:6bbpA	0.100	0.351	9.118E-10	520	0.044	0.158	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
10	PDB:6u3eA	0.100	0.454	3.472E-9	397	0.044	0.204	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
11	PDB:6xu2A	0.121	0.182	9.161E-8	1091	0.074	0.126	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
12	PDB:3w3uA	0.108	0.170	5.513E-7	1030	0.073	0.132	3w3uA.pdb.gz
13	PDB:7unkA	0.082	0.126	6.346E-7	1047	0.086	0.152	7unkA.pdb.gz
14	PDB:3w3zA	0.108	0.172	2.027E-6	1013	0.075	0.137	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
15	AFDB:Q14669	0.082	0.079	3.152E-6	1992	0.099	0.092	Q14669.pdb.gz	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1
16	AFDB:E1JIT7	0.083	0.096	4.032E-6	1601	0.068	0.079	E1JIT7.pdb.gz	PSD_DROME PH and SEC7 domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Efa6 PE=1 SV=2
17	PDB:4a0cA	0.086	0.120	4.097E-6	1155	0.090	0.145	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
18	PDB:7ajuUT	0.107	0.094	4.396E-6	2313	0.084	0.068	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
19	PDB:7mqaLM	0.091	0.087	4.396E-6	2041	0.103	0.094	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:7sukSP	0.077	0.065	4.885E-6	2234	0.077	0.064	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4K7N0	0.0	1360	1741	0.423	0.451	A0A0B4K7N0_DROME Gartenzwerg, isoform C OS=Drosophila melanogaster OX=7227 GN=garz PE=1 SV=1
2	A0A669KB10	0.0	3830	1884	1.000	0.987	A0A669KB10_HUMAN Golgi brefeldin A resistant guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1 PE=1 SV=1
3	A0A669KBG8	0.0	3826	1892	1.000	0.983	A0A669KBG8_HUMAN Golgi brefeldin A resistant guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1 PE=1 SV=1
4	A1Z8W8	0.0	1363	1983	0.423	0.396	A1Z8W8_DROME Gartenzwerg, isoform B OS=Drosophila melanogaster OX=7227 GN=garz PE=1 SV=1
5	A1Z8W9	0.0	1360	1740	0.423	0.452	A1Z8W9_DROME Gartenzwerg, isoform A OS=Drosophila melanogaster OX=7227 GN=garz PE=1 SV=1
6	F1M8X9	0.0	3467	1858	0.939	0.940	F1M8X9_RAT Golgi brefeldin A resistant guanine nucleotide exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Gbf1 PE=1 SV=3
7	G5EGS5	0.0	997	1975	0.332	0.313	GBF1_CAEEL Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 homolog OS=Caenorhabditis elegans OX=6239 GN=gbf-1 PE=3 SV=1
8	Q6DFZ1	0.0	3521	1861	0.940	0.939	Q6DFZ1_MOUSE Golgi-specific brefeldin A-resistance factor 1 OS=Mus musculus OX=10090 GN=Gbf1 PE=1 SV=1
9	Q92538	0.0	3841	1859	1.000	1.000	GBF1_HUMAN Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1 PE=1 SV=2
10	Q8T4A1	1.58e-135	442	726	0.149	0.382	Q8T4A1_DROME AT08349p OS=Drosophila melanogaster OX=7227 GN=garz PE=2 SV=1
11	Q9FLY5	6.42e-106	375	1443	0.154	0.198	GNL1_ARATH ARF guanine-nucleotide exchange factor GNL1 OS=Arabidopsis thaliana OX=3702 GN=GNL1 PE=3 SV=1
12	Q42510	5.91e-105	372	1451	0.123	0.157	GNOM_ARATH ARF guanine-nucleotide exchange factor GNOM OS=Arabidopsis thaliana OX=3702 GN=GN PE=1 SV=1
13	F4K2K3	2.64e-69	260	1375	0.100	0.135	GNL2_ARATH ARF guanine-nucleotide exchange factor GNL2 OS=Arabidopsis thaliana OX=3702 GN=GNL2 PE=2 SV=1
14	Q7TSU1	1.09e-68	259	1791	0.163	0.169	BIG2_RAT Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Rattus norvegicus OX=10116 GN=Arfgef2 PE=1 SV=1
15	Q9P7R8	9.10e-65	246	1462	0.068	0.087	YHV3_SCHPO Uncharacterized protein C211.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC211.03c PE=1 SV=1
16	Q9Y6D5	3.45e-64	244	1785	0.161	0.168	BIG2_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3
17	E7FCG1	1.98e-60	233	1846	0.115	0.115	E7FCG1_DANRE ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited) OS=Danio rerio OX=7955 GN=arfgef2 PE=1 SV=1
18	Q9Y6D6	7.83e-59	227	1849	0.114	0.114	BIG1_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Homo sapiens OX=9606 GN=ARFGEF1 PE=1 SV=2
19	D4A631	8.02e-59	227	1846	0.114	0.115	BIG1_RAT Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Rattus norvegicus OX=10116 GN=Arfgef1 PE=1 SV=1
20	Q9LPC5	1.03e-57	223	1750	0.119	0.127	BIG3_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 3 OS=Arabidopsis thaliana OX=3702 GN=BIG3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16213 DCB	0.00015	33.0	Dimerisation and cyclophilin-binding domain of Mon2
2	PF06299 DUF1045	2.1e+02	13.3	Protein of unknown function (DUF1045)
3	PF09324 DUF1981	34	15.7	Domain of unknown function (DUF1981)
4	PF05527 DUF758	10	17.5	Domain of unknown function (DUF758)
5	PF01369 Sec7	8e-64	226.2	Sec7 domain
6	PF12783 Sec7_N	3.6e-22	90.5	Guanine nucleotide exchange factor in Golgi transport N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359000

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000440005	0.996	ADP-ribosylation factor 1
2	9606.ENSP00000357048	0.989	Coatomer subunit alpha
3	9606.ENSP00000444850	0.966	General vesicular transport factor p115
4	9606.ENSP00000325002	0.956	Coatomer subunit gamma-1
5	9606.ENSP00000314615	0.937	ADP-ribosylation factor GTPase-activating protein 1
6	9606.ENSP00000249923	0.934	Coatomer subunit beta
7	9606.ENSP00000000233	0.928	ADP-ribosylation factor 5
8	9606.ENSP00000400175	0.917	Transforming protein RhoA
9	9606.ENSP00000309415	0.915	Clathrin light chain B
10	9606.ENSP00000402346	0.914	Coatomer subunit gamma-2
11	9606.ENSP00000306010	0.912	ADP-ribosylation factor 4
12	9606.ENSP00000225567	0.911	Golgi SNAP receptor complex member 2
13	9606.ENSP00000242285	0.911	Clathrin light chain A
14	9606.ENSP00000275364	0.902	Guanine nucleotide-binding protein subunit alpha-12
15	9606.ENSP00000400717	0.902	Guanine nucleotide-binding protein subunit alpha-13
16	9606.ENSP00000248572	0.900	Guanine nucleotide-binding protein G(T) subunit gamma-T1
17	9606.ENSP00000481878	0.900	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
18	9606.ENSP00000310226	0.895	Ras-related protein Rab-1B
19	9606.ENSP00000263245	0.879	ADP-ribosylation factor GTPase-activating protein 3
20	9606.ENSP00000256682	0.878	ADP-ribosylation factor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140677	0.987	molecular function activator activity
GO:0030695	0.987	GTPase regulator activity
GO:0005085	0.984	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0006810	0.988	transport
GO:0051641	0.983	cellular localization
GO:0016192	0.959	vesicle-mediated transport
GO:0071840	0.957	cellular component organization or biogenesis
GO:0016043	0.953	cellular component organization
GO:0006996	0.885	organelle organization
GO:0048193	0.841	Golgi vesicle transport
GO:0065007	0.795	biological regulation
GO:0050789	0.768	regulation of biological process
GO:0050794	0.755	regulation of cellular process
GO:0051649	0.688	establishment of localization in cell
GO:0046907	0.653	intracellular transport
GO:0008104	0.582	protein localization
GO:0042147	0.561	retrograde transport, endosome to Golgi
GO:0006892	0.509	post-Golgi vesicle-mediated transport
GO:0006890	0.481	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
GO:0006888	0.413	endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0016050	0.398	vesicle organization
GO:0010256	0.387	endomembrane system organization
GO:0007030	0.359	Golgi organization
GO:0061024	0.343	membrane organization
GO:0006900	0.302	vesicle budding from membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.999	Golgi apparatus
GO:0016020	0.892	membrane
GO:0005829	0.879	cytosol
GO:0031090	0.878	organelle membrane
GO:0031982	0.830	vesicle
GO:0098588	0.774	bounding membrane of organelle
GO:0031984	0.747	organelle subcompartment
GO:0098791	0.670	Golgi apparatus subcompartment
GO:0000139	0.593	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]