StarFunc result for job id Q92540

User Input

>input (1137 residues)
MSLQSAQYLRQAEVLKADMTDSKLGPAEVWTSRQALQDLYQKMLVTDLEYALDKKVEQDL
WNHAFKNQITTLQGQAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTVFNVDLPCR
VKSSQLGIISNKQTHTSAIVKPQSSSCSYICQHCLVHLGDIARYRNQTSQAESYYRHAAQ
LVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNLQKALSKALESRDEV
KTKWGVSDFIKAFIKFHGHVYLSKSLEKLSPLREKLEEQFKRLLFQKAFNSQQLVHVTVI
NLFQLHHLRDFSNETEQHTYSQDEQLCWTQLLALFMSFLGILCKCPLQNESQEESYNAYP
LPAVKVSMDWLRLRPRVFQEAVVDERQYIWPWLISLLNSFHPHEEDLSSISATPLPEEFE
LQGFLALRPSFRNLDFSKGHQGITGDKEGQQRRIRQQRLISIGKWIADNQPRLIQCENEV
GKLLFITEIPELILEDPSEAKENLILQETSVIESLAADGSPGLKSVLSTSRNLSNNCDTG
EKPVVTFKENIKTREVNRDQGRSFPPKEVRRDYSKGITVTKNDGKKDNNKRKTETKKCTL
EKLQETGKQNVAVQVKSQTELRKTPVSEARKTPVTQTPTQASNSQFIPIHHPGAFPPLPS
RPGFPPPTYVIPPPVAFSMGSGYTFPAGVSVPGTFLQPTAHSPAGNQVQAGKQSHIPYSQ
QRPSGPGPMNQGPQQSQPPSQQPLTSLPAQPTAQSTSQLQVQALTQQQQSPTKAVPALGK
SPPHHSGFQQYQQADASKQLWNPPQVQGPLGKIMPVKQPYYLQTQDPIKLFEPSLQPPVM
QQQPLEKKMKPFPMEPYNHNPSEVKVPEFYWDSSYSMADNRSVMAQQANIDRRGKRSPGV
FRPEQDPVPRMPFEKSLLEKPSELMSHSSSFLSLTGFSLNQERYPNNSMFNEVYGKNLTS
SSKAELSPSMAPQETSLYSLFEGTPWSPSLPASSDHSTPASQSPHSSNPSSLPSSPPTHN
HNSVPFSNFGPIGTPDNRDRRTADRWKTDKPAMGGFGIDYLSATSSSESSWHQASTPSGT
WTGHGPSMEDSSAVLMESLKSIWSSSMMHPGPSALEQLLMQQKQKQQRGQGTMNPPH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92540	0.999	0.999	0.000	1137	1.000	1.000	Q92540.pdb.gz	SMG7_HUMAN Nonsense-mediated mRNA decay factor SMG7 OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=2
2	AFDB:E9PD50	0.470	0.457	1.268E-102	1170	0.952	0.925	E9PD50.pdb.gz	E9PD50_HUMAN Nonsense-mediated mRNA decay factor OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=1
3	AFDB:Q1LVF3	0.524	0.506	4.377E-79	1180	0.690	0.665	Q1LVF3.pdb.gz	SMG7_DANRE Nonsense-mediated mRNA decay factor SMG7 OS=Danio rerio OX=7955 GN=smg7 PE=2 SV=2
4	AFDB:B3DI22	0.475	0.478	7.729E-78	1130	0.689	0.693	B3DI22.pdb.gz	B3DI22_DANRE Nonsense-mediated mRNA decay factor OS=Danio rerio OX=7955 GN=wu:fa99h10 PE=1 SV=1
5	AFDB:Q5UIP0	0.097	0.060	1.160E-4	2472	0.129	0.059	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
6	AFDB:F4J8G7	0.101	0.067	4.085E-4	2138	0.158	0.084	F4J8G7.pdb.gz	VIR_ARATH Protein virilizer homolog OS=Arabidopsis thaliana OX=3702 GN=VIR PE=1 SV=1
7	AFDB:Q961B0	0.143	0.149	4.249E-4	1067	0.142	0.151	Q961B0.pdb.gz	Q961B0_DROME LD24920p OS=Drosophila melanogaster OX=7227 GN=Apc2 PE=2 SV=1
8	AFDB:Q9VAS9	0.099	0.065	1.050E-3	2417	0.137	0.065	Q9VAS9.pdb.gz	Q9VAS9_DROME APC-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Apc PE=3 SV=1
9	AFDB:Q57ZA6	0.093	0.075	1.136E-3	1572	0.161	0.116	Q57ZA6.pdb.gz	Q57ZA6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.1020 PE=4 SV=1
10	AFDB:Q9VWE6	0.071	0.051	1.329E-3	2111	0.156	0.084	Q9VWE6.pdb.gz	ELYS_DROME Protein ELYS homolog OS=Drosophila melanogaster OX=7227 GN=Elys PE=1 SV=2
11	PDB:7ntfA	0.088	0.105	2.184E-3	918	0.053	0.065	7ntfA.pdb.gz
12	PDB:4bujB	0.075	0.066	5.187E-3	1367	0.066	0.055	4bujB.pdb.gz
13	PDB:5dseA	0.086	0.134	8.997E-3	537	0.052	0.110	5dseA.pdb.gz
14	PDB:7qe7Y	0.082	0.141	1.232E-2	502	0.053	0.120	7qe7Y.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
15	PDB:7dkhI	0.100	0.115	1.333E-2	914	0.050	0.062	7dkhI.pdb.gz
16	PDB:5mpbQ	0.085	0.146	1.500E-2	434	0.047	0.124	5mpbQ.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
17	PDB:6tedQ	0.101	0.120	1.560E-2	890	0.065	0.083	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
18	PDB:4wjwB	0.096	0.150	1.976E-2	673	0.055	0.094	4wjwB.pdb.gz	Distinct N-terminal regions of the exomer secretory vesicle cargo Chs3 regulate its trafficking itinerary.
19	PDB:7kzpG	0.101	0.160	2.706E-2	577	0.057	0.113	7kzpG.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
20	PDB:4abnB	0.077	0.172	2.815E-2	426	0.045	0.120	4abnB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1ALB4	0.0	1537	756	0.665	1.000	B1ALB4_HUMAN SMG7 nonsense mediated mRNA decay factor (Fragment) OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=8
2	B3DI22	0.0	1370	1130	0.689	0.693	B3DI22_DANRE Nonsense-mediated mRNA decay factor OS=Danio rerio OX=7955 GN=wu:fa99h10 PE=1 SV=1
3	E9PD50	0.0	1997	1170	0.952	0.925	E9PD50_HUMAN Nonsense-mediated mRNA decay factor OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=1
4	Q1LVF3	0.0	1348	1180	0.691	0.666	SMG7_DANRE Nonsense-mediated mRNA decay factor SMG7 OS=Danio rerio OX=7955 GN=smg7 PE=2 SV=2
5	Q92540	0.0	2346	1137	1.000	1.000	SMG7_HUMAN Nonsense-mediated mRNA decay factor SMG7 OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=2
6	A9QM73	7.43e-30	130	1059	0.122	0.131	SMG7_ARATH Nonsense-mediated mRNA decay factor SMG7 OS=Arabidopsis thaliana OX=3702 GN=SMG7 PE=1 SV=1
7	A0A0R4IZ84	8.83e-24	111	1544	0.057	0.042	EST1A_DANRE Telomerase-binding protein EST1A OS=Danio rerio OX=7955 GN=smg6 PE=2 SV=1
8	Q86US8	3.65e-21	102	1419	0.057	0.046	EST1A_HUMAN Telomerase-binding protein EST1A OS=Homo sapiens OX=9606 GN=SMG6 PE=1 SV=2
9	F1R7R1	6.56e-16	85.5	1099	0.064	0.066	SMG5_DANRE Nonsense-mediated mRNA decay factor SMG5 OS=Danio rerio OX=7955 GN=smg5 PE=2 SV=1
10	Q9UPR3	2.29e-15	84.0	1016	0.067	0.075	SMG5_HUMAN Nonsense-mediated mRNA decay factor SMG5 OS=Homo sapiens OX=9606 GN=SMG5 PE=1 SV=3
11	Q86BS8	2.80e-13	77.0	949	0.051	0.061	Q86BS8_DROME SMG6 protein OS=Drosophila melanogaster OX=7227 GN=Smg6 PE=2 SV=1
12	Q9VBZ6	2.80e-13	77.0	948	0.051	0.061	Q9VBZ6_DROME GH14566p OS=Drosophila melanogaster OX=7227 GN=Smg6 PE=2 SV=2
13	Q1T6W7	1.01e-11	72.0	1219	0.058	0.054	Q1T6W7_CAEEL PIN domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=smg-6 PE=1 SV=2
14	G5EF47	3.69e-10	65.9	458	0.046	0.114	G5EF47_CAEEL DNA/RNA-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=smg-7 PE=1 SV=1
15	Q8MZI0	3.46e-09	63.5	688	0.030	0.049	Q8MZI0_DROME GM14040p OS=Drosophila melanogaster OX=7227 GN=Smg6 PE=2 SV=1
16	Q9BL68	8.76e-09	62.4	1241	0.060	0.055	Q9BL68_CAEEL PIN domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=smg-6 PE=1 SV=3
17	Q9V414	2.81e-06	54.3	1177	0.057	0.055	Q9V414_DROME LD36341p OS=Drosophila melanogaster OX=7227 GN=Smg5 PE=1 SV=1
18	A0A1D8PP89	4.79e-04	46.6	612	0.035	0.065	A0A1D8PP89_CANAL Est1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EST1 PE=4 SV=1
19	O74804	0.003	43.9	490	0.038	0.088	EST1_SCHPO Telomere elongation protein est1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=est1 PE=1 SV=1
20	M9PC48	0.016	42.0	18095	0.064	0.004	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10374 EST1	2.3e-16	71.9	Telomerase activating protein Est1
2	PF10373 EST1_DNA_bind	9.6e-52	187.8	Est1 DNA/RNA binding domain
3	PF07719 TPR_2	2e+02	13.5	Tetratricopeptide repeat
4	PF13176 TPR_7	2e+02	13.4	Tetratricopeptide repeat
5	PF07776 zf-AD	1.7e+02	13.8	Zinc-finger associated domain (zf-AD)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000000485

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000010923	0.995	UPF1, RNA helicase and ATPase
2	9601.ENSPPYP00000008072	0.987	Belongs to the PI3/PI4-kinase family.
3	9601.ENSPPYP00000001082	0.983	RNA-binding protein 8A
4	9601.ENSPPYP00000008730	0.974	Uncharacterized protein
5	9601.ENSPPYP00000000838	0.909	SMG5 nonsense mediated mRNA decay factor
6	9601.ENSPPYP00000017108	0.879	Telomerase is a ribonucleoprotein enzyme essential for the replication of chromosome termini in most eukaryotes. Active in progenitor and cancer cells. Inactive, or very low activity, in normal somatic cells. Catalytic component of the teleromerase holoenzyme complex whose main activity is the elongation of telomeres by acting as a reverse transcriptase that adds simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme. Catalyzes the RNA-dependent extension of 3'-chromosomal termini with the 6-nucleotide telomeric repeat unit, 5'- [...]
7	9601.ENSPPYP00000016762	0.832	Uncharacterized protein
8	9601.ENSPPYP00000021769	0.811	Nuclear cap binding protein subunit 1, 80kDa
9	9601.ENSPPYP00000008776	0.797	Component of the telomerase ribonucleoprotein (RNP) complex that is essential for the replication of chromosome termini. May have a general role in telomere regulation. Promotes in vitro the ability of TERT to elongate telomeres. Overexpression induces telomere uncapping, chromosomal end-to-end fusions (telomeric DNA persists at the fusion points) and did not perturb TRF2 telomeric localization. Binds to the single-stranded 5'-(GTGTGG)(4)GTGT-3' telomeric DNA, but not to a telomerase RNA template component (TER).
10	9601.ENSPPYP00000002423	0.738	Uncharacterized protein
11	9601.ENSPPYP00000023142	0.711	UPF3B, regulator of nonsense mediated mRNA decay
12	9601.ENSPPYP00000016158	0.707	Nuclear cap-binding protein subunit 2
13	9601.ENSPPYP00000023075	0.707	Nuclear cap-binding protein subunit 2
14	9601.ENSPPYP00000023744	0.706	SMG9 nonsense mediated mRNA decay factor
15	9601.ENSPPYP00000009242	0.705	SMG8 nonsense mediated mRNA decay factor
16	9601.ENSPPYP00000006310	0.698	UPF3A, regulator of nonsense mediated mRNA decay
17	9601.ENSPPYP00000001999	0.693	Proline-rich nuclear receptor coactivator 2
18	9601.ENSPPYP00000015851	0.693	5'-3' exoribonuclease 1
19	9601.ENSPPYP00000015428	0.653	Decapping mRNA 1A
20	9601.ENSPPYP00000023936	0.652	Sulfotransferase family 1E, estrogen-preferring, member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051721	1.000	protein phosphatase 2A binding
GO:0042162	1.000	telomeric DNA binding
GO:0003723	0.663	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0000184	0.986	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0010467	0.977	gene expression
GO:0033036	0.972	macromolecule localization
GO:0051641	0.967	cellular localization
GO:0006403	0.959	RNA localization
GO:0031323	0.954	regulation of cellular metabolic process
GO:0006406	0.948	mRNA export from nucleus
GO:0035303	0.832	regulation of dephosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0045111	1.000	intermediate filament cytoskeleton
GO:0005634	0.985	nucleus
GO:0043233	0.786	organelle lumen
GO:0070013	0.770	intracellular organelle lumen
GO:0031981	0.760	nuclear lumen
GO:0032991	0.506	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]