StarFunc result for job id Q92541

User Input

>input (710 residues)
MRGRLCVGRAAAAAAAVAVPLAGGQEGSPGGGRRGSRGTTMVKKRKGRVVIDSDTEDSGS
DENLDQELLSLAKRKRSDSEEKEPPVSQPAASSDSETSDSDDEWTFGSNKNKKKGKARKI
EKKGTMKKQANKTASSGSSDKDSSAESSAPEEGEVSDSDSNSSSSSSDSDSSSEDEEFHD
GYGEDLMGDEEDRARLEQMTEKEREQELFNRIEKREVLKRRFEIKKKLKTAKKKEKKEKK
KKQEEEQEKKKLTQIQESQVTSHNKERRSKRDEKLDKKSQAMEELKAEREKRKNRTAELL
AKKQPLKTSEVYSDDEEEEEDDKSSEKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEELN
RVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQLGGT
RTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIK
EALNYKFNDQDIEEIVKEKERFRKAPPNYAMKKTQLLKEKAMAEDLGDQDKAKQIQDQLN
ELEERAEALDRQRTKNISAISYINQRNREWNIVESEKALVAESHNMKNQQMDPFTRRQCK
PTIVSNSRDPAVQAAILAQLNAKYGSGVLPDAPKEMSKGQGKDKDLNSKSASDLSEDLFK
VHDFDVKIDLQVPSSESKALAITSKAPPAKDGAPRRSLNLEDYKKRRGLI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2AQ19	0.370	0.368	7.375E-100	715	0.983	0.976	A2AQ19.pdb.gz	RTF1_MOUSE RNA polymerase-associated protein RTF1 homolog OS=Mus musculus OX=10090 GN=Rtf1 PE=1 SV=1
2	PDB:6tedR	0.297	0.773	1.358E-32	244	0.344	1.000	6tedR.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
3	AFDB:Q6NYV9	0.055	0.057	1.804E-3	696	0.134	0.136	Q6NYV9.pdb.gz	LEO1_DANRE RNA polymerase-associated protein LEO1 OS=Danio rerio OX=7955 GN=leo1 PE=1 SV=1
4	AFDB:O13773	0.071	0.071	1.250E-2	697	0.131	0.133	O13773.pdb.gz	UCP7_SCHPO UBA domain-containing protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ucp7 PE=4 SV=1
5	PDB:7swfA	0.066	0.060	2.079E-2	778	0.025	0.023	7swfA.pdb.gz	The molecular mechanism of microRNA duplex selectivity of Arabidopsis ARGONAUTE10.
6	AFDB:Q94BP0	0.061	0.055	3.810E-2	816	0.128	0.112	Q94BP0.pdb.gz	SLK2_ARATH Probable transcriptional regulator SLK2 OS=Arabidopsis thaliana OX=3702 GN=SLK2 PE=1 SV=1
7	PDB:4w5tA	0.064	0.057	4.726E-2	807	0.027	0.024	4w5tA.pdb.gz	Gene regulation. Structural basis for microRNA targeting.
8	AFDB:F4IS91	0.055	0.034	5.416E-2	1340	0.151	0.080	F4IS91.pdb.gz	RSA1_ARATH Protein SHORT ROOT IN SALT MEDIUM 1 OS=Arabidopsis thaliana OX=3702 GN=RSA1 PE=1 SV=1
9	PDB:5vm9C	0.065	0.059	6.336E-2	785	0.025	0.023	5vm9C.pdb.gz	Human Argonaute3 has slicer activity.
10	PDB:6yxxAT	0.076	0.283	8.012E-2	143	0.023	0.112	6yxxAT.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
11	AFDB:Q16849	0.052	0.041	1.231E-1	979	0.124	0.090	Q16849.pdb.gz	PTPRN_HUMAN Receptor-type tyrosine-protein phosphatase-like N OS=Homo sapiens OX=9606 GN=PTPRN PE=1 SV=1
12	AFDB:P49321	0.076	0.070	1.306E-1	788	0.117	0.105	P49321.pdb.gz	NASP_HUMAN Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2
13	AFDB:Q9VMD0	0.064	0.041	1.384E-1	1659	0.138	0.059	Q9VMD0.pdb.gz	DAXX_DROME Daxx-like protein OS=Drosophila melanogaster OX=7227 GN=Daxx PE=1 SV=3
14	AFDB:Q8H1F0	0.058	0.068	1.856E-1	547	0.128	0.166	Q8H1F0.pdb.gz	BZP29_ARATH bZIP transcription factor 29 OS=Arabidopsis thaliana OX=3702 GN=BZIP29 PE=2 SV=1
15	AFDB:A0A098	0.080	0.066	2.087E-1	934	0.110	0.084	A0A098.pdb.gz	A0A098_CHLRE Gamete-specific minus 1 OS=Chlamydomonas reinhardtii OX=3055 GN=GSM1 PE=1 SV=1
16	PDB:4xgtA	0.074	0.058	2.172E-1	961	0.038	0.028	4xgtA.pdb.gz
17	PDB:7r5jV0	0.072	0.152	2.746E-1	273	0.056	0.147	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
18	PDB:7d4iM4	0.073	0.057	5.234E-1	978	0.031	0.022	7d4iM4.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
19	PDB:6j6qF	0.045	0.126	9.978E-1	161	0.031	0.137	6j6qF.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
20	PDB:6o15A	0.053	0.084	9.978E-1	355	0.025	0.051	6o15A.pdb.gz	On the structure and function of Escherichia coli YjhC: An oxidoreductase involved in bacterial sialic acid metabolism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AQ19	0.0	1414	715	0.983	0.976	RTF1_MOUSE RNA polymerase-associated protein RTF1 homolog OS=Mus musculus OX=10090 GN=Rtf1 PE=1 SV=1
2	A3KDM2	0.0	915	681	0.797	0.831	A3KDM2_DANRE RNA polymerase-associated protein RTF1 homolog OS=Danio rerio OX=7955 GN=wu:fa04h07 PE=1 SV=1
3	Q92541	0.0	1442	710	1.000	1.000	RTF1_HUMAN RNA polymerase-associated protein RTF1 homolog OS=Homo sapiens OX=9606 GN=RTF1 PE=1 SV=4
4	Q9W261	1.83e-96	317	775	0.285	0.261	RTF1_DROME RNA polymerase-associated protein Rtf1 OS=Drosophila melanogaster OX=7227 GN=Rtf1 PE=1 SV=1
5	G5EBY0	1.25e-67	235	613	0.256	0.297	RTF1_CAEEL RNA polymerase-associated protein RTF1 homolog OS=Caenorhabditis elegans OX=6239 GN=rtfo-1 PE=2 SV=1
6	O94667	2.10e-40	158	560	0.179	0.227	RTF1_SCHPO RNA polymerase-associated protein C651.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC651.09c PE=1 SV=1
7	Q5B4G0	3.08e-29	125	600	0.190	0.225	Q5B4G0_EMENI RNA polymerase II transcription elongation factor Rtf1p, putative (AFU_orthologue AFUA_2G01900) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04570 PE=4 SV=1
8	Q8IME7	4.88e-27	117	439	0.090	0.146	Q8IME7_DROME Testis-specific Plus3 domain b OS=Drosophila melanogaster OX=7227 GN=tplus3b PE=4 SV=1
9	Q9C950	1.14e-24	111	643	0.200	0.221	VIP5_ARATH Protein RTF1 homolog OS=Arabidopsis thaliana OX=3702 GN=VIP5 PE=1 SV=1
10	P53064	1.57e-24	110	558	0.154	0.195	RTF1_YEAST RNA polymerase-associated protein RTF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTF1 PE=1 SV=2
11	Q9SIV5	2.04e-06	53.9	1773	0.037	0.015	C3H19_ARATH Zinc finger CCCH domain-containing protein 19 OS=Arabidopsis thaliana OX=3702 GN=NERD PE=1 SV=3
12	A1Z8M2	0.30	37.0	2999	0.079	0.019	A1Z8M2_DROME Toutatis, isoform A OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=2
13	A8DYA3	0.44	36.6	3131	0.079	0.018	A8DYA3_DROME Toutatis, isoform E OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07941 K_channel_TID	8.3e+02	11.8	Potassium channel Kv1.4 tandem inactivation domain
2	PF03126 Plus-3	1.6e-32	123.6	Plus-3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000004375

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000007876	0.999	Leo1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)
2	61853.ENSNLEP00000021390	0.998	CTR9, Paf1/RNA polymerase II complex component
3	61853.ENSNLEP00000017576	0.997	PAF1 homolog, Paf1/RNA polymerase II complex component
4	61853.ENSNLEP00000021930	0.997	Cell division cycle 73
5	61853.ENSNLEP00000015295	0.983	FACT complex subunit SSRP1
6	61853.ENSNLEP00000017482	0.982	Transcription elongation factor SPT5
7	61853.ENSNLEP00000017557	0.978	SPT16 homolog, facilitates chromatin remodeling subunit
8	61853.ENSNLEP00000010406	0.972	WD repeat domain 61
9	61853.ENSNLEP00000011555	0.957	DNA-directed RNA polymerase subunit
10	61853.ENSNLEP00000009953	0.950	Transcription elongation factor SPT4
11	61853.ENSNLEP00000003337	0.942	Transcription elongation factor spt6
12	61853.ENSNLEP00000010889	0.899	DNA-directed RNA polymerase subunit beta
13	61853.ENSNLEP00000003673	0.884	Polymerase (RNA) II (DNA directed) polypeptide C, 33kDa
14	61853.ENSNLEP00000001789	0.875	UBX domain protein 7
15	61853.ENSNLEP00000014230	0.868	DNA-directed RNA polymerase subunit
16	61853.ENSNLEP00000020816	0.867	Ring finger protein 20, E3 ubiquitin protein ligase
17	61853.ENSNLEP00000018225	0.863	Polymerase (RNA) II (DNA directed) polypeptide F
18	61853.ENSNLEP00000017650	0.861	Chromodomain helicase DNA binding protein 1
19	61853.ENSNLEP00000004949	0.854	Polymerase (RNA) II (DNA directed) polypeptide G
20	61853.ENSNLEP00000001458	0.852	Polymerase (RNA) II (DNA directed) polypeptide E, 25kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.799	heterocyclic compound binding
GO:0097159	0.799	organic cyclic compound binding
GO:0003676	0.791	nucleic acid binding
GO:0003723	0.653	RNA binding
GO:0003697	0.355	single-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0071704	0.985	organic substance metabolic process
GO:0044238	0.983	primary metabolic process
GO:0044237	0.979	cellular metabolic process
GO:0006807	0.975	nitrogen compound metabolic process
GO:0043170	0.973	macromolecule metabolic process
GO:0032502	0.949	developmental process
GO:0050789	0.915	regulation of biological process
GO:0032501	0.906	multicellular organismal process
GO:0050794	0.897	regulation of cellular process
GO:0006351	0.886	DNA-templated transcription
GO:0019222	0.847	regulation of metabolic process
GO:0098727	0.839	maintenance of cell number
GO:0060255	0.828	regulation of macromolecule metabolic process
GO:0051171	0.821	regulation of nitrogen compound metabolic process
GO:0080090	0.776	regulation of primary metabolic process
GO:0031323	0.775	regulation of cellular metabolic process
GO:0019827	0.666	stem cell population maintenance
GO:0006366	0.620	transcription by RNA polymerase II
GO:0019219	0.616	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.540	regulation of gene expression
GO:0048518	0.531	positive regulation of biological process
GO:0031326	0.521	regulation of cellular biosynthetic process
GO:0048522	0.519	positive regulation of cellular process
GO:0051252	0.519	regulation of RNA metabolic process
GO:0010604	0.503	positive regulation of macromolecule metabolic process
GO:0051173	0.500	positive regulation of nitrogen compound metabolic process
GO:0006355	0.498	regulation of DNA-templated transcription
GO:0031325	0.492	positive regulation of cellular metabolic process
GO:1901564	0.459	organonitrogen compound metabolic process
GO:0048856	0.434	anatomical structure development
GO:0019538	0.422	protein metabolic process
GO:0036211	0.407	protein modification process
GO:0048519	0.375	negative regulation of biological process
GO:0048523	0.370	negative regulation of cellular process
GO:0006357	0.351	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0140513	0.995	nuclear protein-containing complex
GO:0140535	0.990	intracellular protein-containing complex
GO:0061695	0.988	transferase complex, transferring phosphorus-containing groups
GO:0055029	0.935	nuclear DNA-directed RNA polymerase complex
GO:0016591	0.934	RNA polymerase II, holoenzyme
GO:0043232	0.880	intracellular non-membrane-bounded organelle
GO:0008023	0.870	transcription elongation factor complex
GO:0005737	0.737	cytoplasm
GO:0016593	0.377	Cdc73/Paf1 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]