StarFunc result for job id Q92543

User Input

>input (992 residues)
MKTETVPPFQETPAGSSCHLNNLLSSRKLMAVGVLLGWLLVIHLLVNVWLLCLLSALLVV
LGGWLGSSLAGVASGRLHLERFIPLATCPPCPEAERQLEREINRTIQMIIRDFVLSWYRS
VSQEPAFEEEMEAAMKGLVQELRRRMSVMDSHAVAQSVLTLCGCHLQSYIQAKEATAGKN
GPVEPSHLWEAYCRATAPHPAVHSPSAEVTYTRGVVNLLLQGLVPKPHLETRTGRHVVVE
LITCNVILPLISRLSDPDWIHLVLVGIFSKARDPAPCPASAPEQPSVPTSLPLIAEVEQL
PEGRASPVAAPVFLSYSEPEGSAGPSPEVEEGHEAVEGDLGGMCEERKVGNNSSHFLQPN
VRGPLFLCEDSELESPLSELGKETIMLMTPGSFLSDRIQDALCALESSQALEPKDGEASE
GAEAEEGPGTETETGLPVSTLNSCPEIHIDTADKEIEQGDVTASVTALLEGPEKTCPSRP
SCLEKDLTNDVSSLDPTLPPVLLSSSPPGPLSSATFSFEPLSSPDGPVIIQNLRITGTIT
AREHSGTGFHPYTLYTVKYETALDGENSSGLQQLAYHTVNRRYREFLNLQTRLEEKPDLR
KFIKNVKGPKKLFPDLPLGNMDSDRVEARKSLLESFLKQLCAIPEIANSEEVQEFLALNT
DARIAFVKKPFMVSRIDKMVVSAIVDTLKTAFPRSEPQSPTEELSEAETESKPQTEGKKA
SKSRLRFSSSKISPALSVTEAQDKILYCLQEGNVESETLSMSAMESFIEKQTKLLEMQPT
KAPEKDPEQPPKGRVDSCVSDAAVPAQDPSNSDPGTETELADTALDLLLLLLTEQWKWLC
TENMQKFLRLIFGTLVQRWLEVQVANLTSPQRWVQYLLLLQESIWPGGVLPKFPRPVRTQ
EQKLAAEKQALQSLMGVLPDLVVEILGVNKCRLSWGLVLESLQQPLINRHLIYCLGDIIL
EFLDLSASVEESAATTSASDTPGNSKRMGVSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92543	1.000	1.000	0.000	992	1.000	1.000	Q92543.pdb.gz	SNX19_HUMAN Sorting nexin-19 OS=Homo sapiens OX=9606 GN=SNX19 PE=1 SV=2
2	AFDB:Q6P4T1	0.594	0.592	2.146E-100	997	0.816	0.811	Q6P4T1.pdb.gz	SNX19_MOUSE Sorting nexin-19 OS=Mus musculus OX=10090 GN=Snx19 PE=1 SV=1
3	AFDB:Q584L1	0.054	0.077	9.608E-4	669	0.085	0.126	Q584L1.pdb.gz	Q584L1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3M17.250 PE=4 SV=1
4	PDB:2mxcA	0.099	0.451	3.940E-3	172	0.037	0.215	2mxcA.pdb.gz
5	PDB:2dybA	0.093	0.285	4.123E-3	298	0.031	0.104	2dybA.pdb.gz
6	AFDB:Q57YV0	0.039	0.054	8.119E-3	635	0.075	0.117	Q57YV0.pdb.gz	Q57YV0_TRYB2 NOT2/NOT3/NOT5 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.40 PE=4 SV=1
7	AFDB:H2KY58	0.046	0.059	1.465E-2	748	0.093	0.123	H2KY58.pdb.gz	H2KY58_CAEEL ALG-1 OS=Caenorhabditis elegans OX=6239 GN=ain-2 PE=1 SV=1
8	PDB:1ocuA	0.078	0.461	2.777E-2	134	0.029	0.216	1ocuA.pdb.gz	Crystal structure of the yeast Phox homology (PX) domain protein Grd19p complexed to phosphatidylinositol-3-phosphate.
9	AFDB:A3KNA7	0.057	0.054	5.224E-2	1099	0.104	0.094	A3KNA7.pdb.gz	SRBP2_DANRE Sterol regulatory element-binding protein 2 OS=Danio rerio OX=7955 GN=srebf2 PE=1 SV=1
10	AFDB:P56720	0.049	0.049	1.131E-1	1134	0.093	0.081	P56720.pdb.gz	SRBP1_RAT Sterol regulatory element-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Srebf1 PE=1 SV=3
11	AFDB:Q387G7	0.057	0.061	1.131E-1	835	0.117	0.139	Q387G7.pdb.gz	Q387G7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0310 PE=4 SV=1
12	AFDB:Q9C5H5	0.046	0.056	1.419E-1	716	0.106	0.147	Q9C5H5.pdb.gz	M3K5G_ARATH Mitogen-activated protein kinase kinase kinase 5 OS=Arabidopsis thaliana OX=3702 GN=MAPKKK5 PE=1 SV=1
13	AFDB:Q6AWX6	0.041	0.049	1.863E-1	821	0.079	0.095	Q6AWX6.pdb.gz	SCAR1_ARATH Protein SCAR1 OS=Arabidopsis thaliana OX=3702 GN=SCAR1 PE=1 SV=1
14	PDB:7d6dA	0.102	0.229	2.455E-1	380	0.066	0.171	7d6dA.pdb.gz
15	PDB:7r7jB	0.043	0.064	6.089E-1	574	0.017	0.030	7r7jB.pdb.gz	X-ray crystal structure of the Escherichia coli RadD DNA repair protein bound to ADP reveals a novel zinc ribbon domain.
16	PDB:3upuA	0.043	0.082	9.162E-1	439	0.010	0.023	3upuA.pdb.gz	The T4 Phage SF1B Helicase Dda Is Structurally Optimized to Perform DNA Strand Separation.
17	PDB:1nbhA	0.034	0.091	9.588E-1	292	0.006	0.021	1nbhA.pdb.gz	Catalytic mechanism of glycine N-methyltransferase
18	PDB:6ro1A	0.061	0.064	1.050	919	0.045	0.049	6ro1A.pdb.gz	The MTR4 helicase recruits nuclear adaptors of the human RNA exosome using distinct arch-interacting motifs.
19	PDB:6rupA	0.041	0.225	1.318	111	0.006	0.054	6rupA.pdb.gz	Dominant mutations in mtDNA maintenance gene SSBP1 cause optic atrophy and foveopathy.
20	PDB:1fa9A	0.048	0.055	1.379	834	0.016	0.019	1fa9A.pdb.gz	Activation of human liver glycogen phosphorylase by alteration of the secondary structure and packing of the catalytic core.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6P4T1	0.0	1582	997	0.818	0.813	SNX19_MOUSE Sorting nexin-19 OS=Mus musculus OX=10090 GN=Snx19 PE=1 SV=1
2	Q92543	0.0	2013	992	1.000	1.000	SNX19_HUMAN Sorting nexin-19 OS=Homo sapiens OX=9606 GN=SNX19 PE=1 SV=2
3	Q8BHY8	1.52e-11	71.2	964	0.046	0.048	SNX14_MOUSE Sorting nexin-14 OS=Mus musculus OX=10090 GN=Snx14 PE=1 SV=2
4	F1QM62	4.50e-11	69.7	955	0.043	0.045	F1QM62_DANRE Sorting nexin 13 OS=Danio rerio OX=7955 GN=snx13 PE=3 SV=3
5	Q9Y5W7	4.84e-11	69.3	946	0.046	0.049	SNX14_HUMAN Sorting nexin-14 OS=Homo sapiens OX=9606 GN=SNX14 PE=1 SV=3
6	D6RJG9	4.86e-11	69.3	935	0.046	0.049	D6RJG9_HUMAN Sorting nexin 14 OS=Homo sapiens OX=9606 GN=SNX14 PE=1 SV=2
7	Q5PNP1	1.91e-09	64.3	934	0.046	0.049	SNX14_DANRE Sorting nexin-14 OS=Danio rerio OX=7955 GN=snx14 PE=2 SV=3
8	Q9Y5W8	2.71e-09	63.9	968	0.059	0.061	SNX13_HUMAN Sorting nexin-13 OS=Homo sapiens OX=9606 GN=SNX13 PE=1 SV=4
9	Q9W3N0	9.69e-07	55.5	1117	0.034	0.030	Q9W3N0_DROME FI21262p1 OS=Drosophila melanogaster OX=7227 GN=snz PE=2 SV=2
10	Q8T4E8	1.04e-06	55.5	1117	0.034	0.030	Q8T4E8_DROME AT01932p OS=Drosophila melanogaster OX=7227 GN=snz PE=2 SV=1
11	A0A494C0S0	9.74e-06	52.0	1004	0.036	0.036	A0A494C0S0_HUMAN Sorting nexin 25 OS=Homo sapiens OX=9606 GN=SNX25 PE=1 SV=1
12	Q9H3E2	2.51e-05	50.8	840	0.036	0.043	SNX25_HUMAN Sorting nexin-25 OS=Homo sapiens OX=9606 GN=SNX25 PE=1 SV=2
13	Q3ZT31	3.29e-05	50.4	840	0.038	0.045	SNX25_MOUSE Sorting nexin-25 OS=Mus musculus OX=10090 GN=Snx25 PE=1 SV=3
14	Q9CY18	1.11e-04	48.1	387	0.058	0.150	SNX7_MOUSE Sorting nexin-7 OS=Mus musculus OX=10090 GN=Snx7 PE=1 SV=1
15	Q86IF6	2.87e-04	47.0	545	0.044	0.081	Q86IF6_DICDI Phox domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=vps5 PE=4 SV=1
16	Q13596	6.39e-04	45.8	522	0.077	0.146	SNX1_HUMAN Sorting nexin-1 OS=Homo sapiens OX=9606 GN=SNX1 PE=1 SV=3
17	Q99N27	0.001	45.4	522	0.041	0.079	SNX1_RAT Sorting nexin-1 OS=Rattus norvegicus OX=10116 GN=Snx1 PE=1 SV=1
18	Q9USN1	0.001	45.1	1010	0.034	0.034	SNX12_SCHPO Sorting nexin-12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snx12 PE=3 SV=1
19	Q9WV80	0.001	45.4	522	0.041	0.079	SNX1_MOUSE Sorting nexin-1 OS=Mus musculus OX=10090 GN=Snx1 PE=1 SV=1
20	A0A0R4IBS8	0.002	44.3	469	0.055	0.117	A0A0R4IBS8_DANRE Sorting nexin 7 OS=Danio rerio OX=7955 GN=zgc:92458 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08628 Nexin_C	1.3e-18	78.9	Sorting nexin C terminal
2	PF00787 PX	8.3e-13	60.2	PX domain
3	PF02194 PXA	2.7e-35	133.6	PXA domain
4	PF17541 TssC	6.8e+02	10.5	Type VI secretion system, TssC, VipB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265909

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000278200	0.708	Mitochondrial inner membrane protease subunit 1
2	9606.ENSP00000318373	0.660	Zinc finger protein 513
3	9606.ENSP00000369465	0.634	Gamma-taxilin
4	9606.ENSP00000483523	0.629	Nucleolar protein 4 like
5	9606.ENSP00000370303	0.627	Palmitoyltransferase ZDHHC21
6	9606.ENSP00000302537	0.620	Nuclear protein MDM1
7	9606.ENSP00000415786	0.619	Glia-derived nexin
8	9606.ENSP00000458762	0.588	NmrA-like family domain-containing protein 1
9	9606.ENSP00000263563	0.586	Paladin
10	9606.ENSP00000295718	0.558	Receptor-type tyrosine-protein phosphatase-like N
11	9606.ENSP00000423881	0.552	PACRG-like protein
12	9606.ENSP00000349124	0.536	Serine/threonine-protein phosphatase 4 regulatory subunit 2
13	9606.ENSP00000400459	0.532	Clathrin coat assembly protein AP180
14	9606.ENSP00000374069	0.519	Receptor-type tyrosine-protein phosphatase N2
15	9606.ENSP00000380998	0.518	Charged multivesicular body protein 1a
16	9606.ENSP00000355880	0.510	Mitochondrial amidoxime reducing component 2
17	9606.ENSP00000386563	0.505	MORN repeat-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005543	0.300	phospholipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	1.000	cellular process
GO:0008150	1.000	biological_process
GO:0065007	0.994	biological regulation
GO:0032501	0.975	multicellular organismal process
GO:0048856	0.969	anatomical structure development
GO:0010817	0.968	regulation of hormone levels
GO:0032940	0.968	secretion by cell
GO:0016043	0.966	cellular component organization
GO:0007267	0.966	cell-cell signaling
GO:0071705	0.965	nitrogen compound transport
GO:0010256	0.964	endomembrane system organization
GO:0009306	0.958	protein secretion
GO:0016050	0.957	vesicle organization
GO:0023061	0.957	signal release
GO:0030154	0.956	cell differentiation
GO:0001501	0.955	skeletal system development
GO:0002062	0.952	chondrocyte differentiation
GO:0030072	0.952	peptide hormone secretion
GO:0033363	0.941	secretory granule organization
GO:0030073	0.941	insulin secretion
GO:0021700	0.828	developmental maturation
GO:0050789	0.328	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.953	intracellular membrane-bounded organelle
GO:0012505	0.912	endomembrane system
GO:0031982	0.568	vesicle
GO:0016020	0.350	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]