StarFunc result for job id Q92545

User Input

>input (1883 residues)
MGKRAGGGATGATTAAVSTSAGAGLEPAAARSGGPRSAAAGLLGALHLVMTLVVAAARAE
KEAFVQSESIIEVLRFDDGGLLQTETTLGLSSYQQKSISLYRGNCRPIRFEPPMLDFHEQ
PVGMPKMEKVYLHNPSSEETITLVSISATTSHFHASFFQNRKILPGGNTSFDVVFLARVV
GNVENTLFINTSNHGVFTYQVFGVGVPNPYRLRPFLGARVPVNSSFSPIINIHNPHSEPL
QVVEMYSSGGDLHLELPTGQQGGTRKLWEIPPYETKGVMRASFSSREADNHTAFIRIKTN
ASDSTEFIILPVEVEVTTAPGIYSSTEMLDFGTLRTQDLPKVLNLHLLNSGTKDVPITSV
RPTPQNDAITVHFKPITLKASESKYTKVASISFDASKAKKPSQFSGKITVKAKEKSYSKL
EIPYQAEVLDGYLGFDHAATLFHIRDSPADPVERPIYLTNTFSFAILIHDVLLPEEAKTM
FKVHNFSKPVLILPNESGYIFTLLFMPSTSSMHIDNNILLITNASKFHLPVRVYTGFLDY
FVLPPKIEERFIDFGVLSATEASNILFAIINSNPIELAIKSWHIIGDGLSIELVAVERGN
RTTIISSLPEFEKSSLSDQSSVTLASGYFAVFRVKLTAKKLEGIHDGAIQITTDYEILTI
PVKAVIAVGSLTCFPKHVVLPPSFPGKIVHQSLNIMNSFSQKVKIQQIRSLSEDVRFYYK
RLRGNKEDLEPGKKSKIANIYFDPGLQCGDHCYVGLPFLSKSEPKVQPGVAMQEDMWDAD
WDLHQSLFKGWTGIKENSGHRLSAIFEVNTDLQKNIISKITAELSWPSILSSPRHLKFPL
TNTNCSSEEEITLENPADVPVYVQFIPLALYSNPSVFVDKLVSRFNLSKVAKIDLRTLEF
QVFRNSAHPLQSSTGFMEGLSRHLILNLILKPGEKKSVKVKFTPVHNRTVSSLIIVRNNL
TVMDAVMVQGQGTTENLRVAGKLPGPGSSLRFKITEALLKDCTDSLKLREPNFTLKRTFK
VENTGQLQIHIETIEISGYSCEGYGFKVVNCQEFTLSANASRDIIILFTPDFTASRVIRE
LKFITTSGSEFVFILNASLPYHMLATCAEALPRPNWELALYIIISGIMSALFLLVIGTAY
LEAQGIWEPFRRRLSFEASNPPFDVGRPFDLRRIVGISSEGNLNTLSCDPGHSRGFCGAG
GSSSRPSAGSHKQCGPSVHPHSSHSNRNSADVENVRAKNSSSTSSRTSAQAASSQSANKT
SPLVLDSNTVTQGHTAGRKSKGAKQSQHGSQHHAHSPLEQHPQPPLPPPVPQPQEPQPER
LSPAPLAHPSHPERASSARHSSEDSDITSLIEAMDKDFDHHDSPALEVFTEQPPSPLPKS
KGKGKPLQRKVKPPKKQEEKEKKGKGKPQEDELKDSLADDDSSSTTTETSNPDTEPLLKE
DTEKQKGKQAMPEKHESEMSQVKQKSKKLLNIKKEIPTDVKPSSLELPYTPPLESKQRRN
LPSKIPLPTAMTSGSKSRNAQKTKGTSKLVDNRPPALAKFLPNSQELGNTSSSEGEKDSP
PPEWDSVPVHKPGSSTDSLYKLSLQTLNADIFLKQRQTSPTPASPSPPAAPCPFVARGSY
SSIVNSSSSSDPKIKQPNGSKHKLTKAASLPGKNGNPTFAAVTAGYDKSPGGNGFAKVSS
NKTGFSSSLGISHAPVDSDGSDSSGLWSPVSNPSSPDFTPLNSFSAFGNSFNLTGEVFSK
LGLSRSCNQASQRSWNEFNSGPSYLWESPATDPSPSWPASSGSPTHTATSVLGNTSGLWS
TTPFSSSIWSSNLSSALPFTTPANTLASIGLMGTENSPAPHAPSTSSPADDLGQTYNPWR
IWSPTIGRRSSDPWSNSHFPHEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q18264	0.284	0.290	7.811E-102	1831	0.216	0.222	Q18264.pdb.gz	Q18264_CAEEL TMEM131_like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tmem-131 PE=1 SV=4
2	AFDB:A2VDJ0	0.166	0.191	8.228E-69	1609	0.219	0.256	A2VDJ0.pdb.gz	T131L_HUMAN Transmembrane protein 131-like OS=Homo sapiens OX=9606 GN=TMEM131L PE=1 SV=2
3	PDB:7sqcO0	0.095	0.141	1.880E-41	1140	0.069	0.114	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
4	AFDB:A0A0R4IZF0	0.060	0.060	1.006E-24	1907	0.116	0.114	A0A0R4IZF0.pdb.gz
5	AFDB:M9NE05	0.107	0.097	5.972E-24	2192	0.121	0.104	M9NE05.pdb.gz	M9NE05_DROME Neuromusculin, isoform E OS=Drosophila melanogaster OX=7227 GN=nrm PE=4 SV=1
6	AFDB:Q99PJ1	0.056	0.055	2.161E-23	1943	0.120	0.116	Q99PJ1.pdb.gz	PCD15_MOUSE Protocadherin-15 OS=Mus musculus OX=10090 GN=Pcdh15 PE=1 SV=3
7	AFDB:Q0ZM14	0.058	0.057	1.283E-22	1899	0.110	0.109	Q0ZM14.pdb.gz	PCD15_CHICK Protocadherin-15 OS=Gallus gallus OX=9031 GN=Pcdh15 PE=1 SV=1
8	AFDB:Q9VGW1	0.071	0.069	1.564E-22	1943	0.116	0.113	Q9VGW1.pdb.gz	CAD86_DROME Cadherin-86C OS=Drosophila melanogaster OX=7227 GN=Cad86C PE=2 SV=3
9	AFDB:O55005	0.076	0.084	2.564E-22	1651	0.122	0.139	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
10	AFDB:F1R2D2	0.074	0.080	1.482E-20	1687	0.126	0.140	F1R2D2.pdb.gz
11	PDB:7q5zA	0.062	0.078	6.634E-18	1344	0.055	0.077	7q5zA.pdb.gz
12	PDB:5a42A	0.078	0.086	2.285E-17	1597	0.054	0.064	5a42A.pdb.gz
13	PDB:7q1yA	0.061	0.076	2.926E-17	1374	0.060	0.082	7q1yA.pdb.gz
14	PDB:4lnvA	0.090	0.118	1.825E-16	1276	0.050	0.074	4lnvA.pdb.gz
15	PDB:7vonA	0.066	0.081	2.849E-16	1399	0.056	0.075	7vonA.pdb.gz
16	PDB:7nycA	0.102	0.116	1.320E-15	1542	0.053	0.064	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
17	PDB:6h03A	0.099	0.133	8.652E-15	1223	0.046	0.070	6h03A.pdb.gz
18	PDB:7u05A	0.072	0.102	5.669E-14	1114	0.035	0.059	7u05A.pdb.gz
19	PDB:4rtdA	0.057	0.080	6.259E-14	1122	0.042	0.070	4rtdA.pdb.gz
20	AFDB:P12259	0.052	0.046	5.367E-9	2224	0.118	0.100	P12259.pdb.gz	FA5_HUMAN Coagulation factor V OS=Homo sapiens OX=9606 GN=F5 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0P631	4.41e-168	513	263	0.135	0.970	Q0P631_HUMAN TMEM131 protein OS=Homo sapiens OX=9606 GN=TMEM131 PE=1 SV=1
2	Q18264	1.92e-121	427	1831	0.163	0.167	Q18264_CAEEL TMEM131_like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tmem-131 PE=1 SV=4
3	Q9V7H4	8.83e-72	269	1567	0.106	0.128	TM131_DROME Transmembrane protein 131 homolog OS=Drosophila melanogaster OX=7227 GN=CG8370 PE=1 SV=2
4	A2VDJ0	5.63e-68	257	1609	0.083	0.098	T131L_HUMAN Transmembrane protein 131-like OS=Homo sapiens OX=9606 GN=TMEM131L PE=1 SV=2
5	M9PB32	0.030	42.0	19560	0.064	0.006	M9PB32_DROME Dumpy, isoform AA OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
6	M9PBZ0	0.072	40.8	22830	0.064	0.005	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
7	M9PC45	0.072	40.8	22300	0.064	0.005	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
8	M9PB30	0.075	40.8	22949	0.064	0.005	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
9	M9PC41	0.076	40.8	22743	0.064	0.005	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
10	B2RTY4	0.12	40.0	2548	0.015	0.011	MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens OX=9606 GN=MYO9A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15780 ASH	9.5e-06	37.1	Abnormal spindle-like microcephaly-assoc'd, ASPM-SPD-2-Hydin
2	PF07610 DUF1573	0.00011	33.4	Protein of unknown function (DUF1573)
3	PF06280 fn3_5	67	15.6	Fn3-like domain
4	PF19532 TMEM131_like	1.1e-140	482.4	Transmembrane protein 131-like
5	PF12371 TMEM131_like_N	1.7e-19	81.2	Transmembrane protein 131-like N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000186436

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000478754	0.868	Probable ATP-dependent RNA helicase DDX6
2	9606.ENSP00000352821	0.767	Probable palmitoyltransferase ZDHHC14
3	9606.ENSP00000295851	0.650	Abl interactor 2
4	9606.ENSP00000310565	0.641	Dermatan-sulfate epimerase-like protein
5	9606.ENSP00000422168	0.634	SH3 domain-binding protein 2
6	9606.ENSP00000371614	0.531	Serine/threonine-protein kinase BRSK2
7	9606.ENSP00000431459	0.515	Leucine repeat adapter protein 25

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.987	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0009987	0.822	cellular process
GO:0048583	0.574	regulation of response to stimulus
GO:0048523	0.550	negative regulation of cellular process
GO:0023051	0.462	regulation of signaling
GO:0010646	0.462	regulation of cell communication
GO:0009966	0.393	regulation of signal transduction
GO:0071840	0.355	cellular component organization or biogenesis
GO:0002682	0.312	regulation of immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	0.998	cytoplasm
GO:0012505	0.991	endomembrane system
GO:0043231	0.966	intracellular membrane-bounded organelle
GO:0031090	0.783	organelle membrane
GO:0071944	0.737	cell periphery
GO:0005886	0.684	plasma membrane
GO:0005783	0.423	endoplasmic reticulum
GO:0005829	0.383	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]