StarFunc result for job id Q92546

User Input

>input (391 residues)
MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASSEALAWASAQIHCQFHASESRV
ALPPPDSSQPDVQPDSQTVFLPHRGERGQCILSTPPKILFCDLRLDPGESKSYSYSEVLP
IEGPPSFRGQSVKYVYKLTIGCQRVNSPITLLRVPLRVLVLTGLQDVRFPQDEAVAPSSP
FLEEDEGGKKDSWLAELAGERLMAATSCRSLHLYNISDGRGKVGTFGIFKSVYRLGEDVV
GTLNLGEGTVACLQFSVSLQTEERVQPEYQRRRGAGGVPSVSHVTHARHQESCLHTTRTS
FSLPIPLSSTPGFCTAIVSLKWRLHFEFVTSREPGLVLLPPVEQPEPTTWTGPEQVPVDT
FSWDLPIKVLPTSPTLASYAAPGPSTSTITI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92546	1.000	1.000	4.160E-78	391	1.000	1.000	Q92546.pdb.gz	RGP1_HUMAN RAB6A-GEF complex partner protein 2 OS=Homo sapiens OX=9606 GN=RGP1 PE=1 SV=1
2	AFDB:A0A0C4DHA5	0.794	0.706	7.997E-37	443	0.384	0.339	A0A0C4DHA5.pdb.gz	A0A0C4DHA5_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Rgp1 PE=1 SV=1
3	AFDB:O60183	0.628	0.455	7.170E-21	550	0.202	0.144	O60183.pdb.gz	SAT1_SCHPO Protein sat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sat1 PE=4 SV=1
4	AFDB:Q8RWU2	0.592	0.443	2.992E-18	532	0.243	0.179	Q8RWU2.pdb.gz	Q8RWU2_ARATH Immunoglobulin OS=Arabidopsis thaliana OX=3702 GN=LOT PE=1 SV=1
5	AFDB:P16664	0.611	0.384	6.113E-17	663	0.199	0.118	P16664.pdb.gz	RGP1_YEAST Guanine nucleotide exchange factor subunit RGP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RGP1 PE=1 SV=2
6	AFDB:Q9XXI4	0.495	0.466	1.123E-15	419	0.141	0.131	Q9XXI4.pdb.gz	Q9XXI4_CAEEL Arrestin C-terminal-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=arrd-7 PE=1 SV=2
7	AFDB:Q9VGU4	0.491	0.382	1.715E-15	520	0.115	0.087	Q9VGU4.pdb.gz	Q9VGU4_DROME FI02822p OS=Drosophila melanogaster OX=7227 GN=Leash PE=2 SV=2
8	AFDB:P40335	0.492	0.505	1.809E-15	379	0.128	0.132	P40335.pdb.gz	PEP8_YEAST Carboxypeptidase Y-deficient protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PEP8 PE=1 SV=2
9	AFDB:A0A1D8PJS7	0.476	0.528	1.216E-14	347	0.123	0.138	A0A1D8PJS7.pdb.gz	A0A1D8PJS7_CANAL Retromer subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PEP8 PE=3 SV=1
10	AFDB:Q86KB1	0.469	0.320	1.584E-14	617	0.113	0.071	Q86KB1.pdb.gz	ADCB_DICDI Arrestin domain-containing protein B OS=Dictyostelium discoideum OX=44689 GN=adcB PE=3 SV=1
11	PDB:5f0jB	0.488	0.602	8.775E-14	306	0.115	0.147	5f0jB.pdb.gz
12	PDB:2r51A	0.532	0.697	1.490E-13	288	0.120	0.163	2r51A.pdb.gz
13	PDB:3gc3A	0.417	0.484	3.759E-10	329	0.105	0.125	3gc3A.pdb.gz
14	PDB:2wtrB	0.424	0.448	1.840E-9	367	0.118	0.125	2wtrB.pdb.gz
15	PDB:3gd1E	0.388	0.483	2.273E-9	300	0.110	0.143	3gd1E.pdb.gz	Structure of an arrestin2-clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking
16	PDB:7jsmB	0.399	0.406	2.664E-9	383	0.115	0.117	7jsmB.pdb.gz
17	PDB:5w0pC	0.411	0.218	3.472E-9	850	0.095	0.044	5w0pC.pdb.gz
18	PDB:5tv1A	0.388	0.438	8.537E-9	337	0.118	0.136	5tv1A.pdb.gz	Structural basis of arrestin-3 activation and signaling.
19	PDB:7tvzE	0.233	0.148	3.291E-7	665	0.079	0.047	7tvzE.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
20	PDB:1l9mB	0.220	0.136	4.768E-7	681	0.072	0.041	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q92546	0.0	789	391	1.000	1.000	RGP1_HUMAN RAB6A-GEF complex partner protein 2 OS=Homo sapiens OX=9606 GN=RGP1 PE=1 SV=1
2	A0A0C4DHA5	4.58e-68	223	443	0.396	0.350	A0A0C4DHA5_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Rgp1 PE=1 SV=1
3	Q8RWU2	7.54e-07	53.5	532	0.113	0.083	Q8RWU2_ARATH Immunoglobulin OS=Arabidopsis thaliana OX=3702 GN=LOT PE=1 SV=1
4	O60183	0.001	43.1	550	0.046	0.033	SAT1_SCHPO Protein sat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sat1 PE=4 SV=1
5	Q9BT22	2.9	32.3	464	0.036	0.030	ALG1_HUMAN Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG1 PE=1 SV=2
6	F7J1C8	6.8	30.8	249	0.041	0.064	E3GAL_FLAVE Galactan endo-beta-1,3-galactanase OS=Flammulina velutipes OX=38945 GN=EN3GAL PE=1 SV=1
7	Q06RG9	7.2	31.2	525	0.038	0.029	Q06RG9_DROME Helmsman OS=Drosophila melanogaster OX=7227 GN=verm PE=2 SV=1
8	Q8IQU1	7.5	31.2	525	0.038	0.029	Q8IQU1_DROME LD36620p OS=Drosophila melanogaster OX=7227 GN=verm PE=1 SV=1
9	E1JI40	8.2	31.2	555	0.038	0.027	E1JI40_DROME Vermiform, isoform I OS=Drosophila melanogaster OX=7227 GN=verm PE=1 SV=1
10	Q9VW31	8.3	31.2	531	0.038	0.028	Q9VW31_DROME Vermiform, isoform H OS=Drosophila melanogaster OX=7227 GN=verm PE=1 SV=2
11	P47150	9.3	30.4	247	0.043	0.069	RT07_YEAST Small ribosomal subunit protein uS7m OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSM7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08737 Rgp1	2.3e-42	157.3	Rgp1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000005019

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000011057	0.984	RAB6A GEF complex partner 1
2	61853.ENSNLEP00000017293	0.831	Eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa
3	61853.ENSNLEP00000008323	0.741	VPS52, GARP complex subunit
4	61853.ENSNLEP00000012043	0.728	VPS54, GARP complex subunit
5	61853.ENSNLEP00000000589	0.721	VPS53, GARP complex subunit
6	61853.ENSNLEP00000000992	0.711	RAB41, member RAS oncogene family
7	61853.ENSNLEP00000004426	0.711	RAB6B, member RAS oncogene family
8	61853.ENSNLEP00000019073	0.711	Uncharacterized protein
9	61853.ENSNLEP00000020764	0.711	Uncharacterized protein
10	61853.ENSNLEP00000017593	0.682	RAB43, member RAS oncogene family
11	61853.ENSNLEP00000007422	0.680	Eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa
12	61853.ENSNLEP00000017029	0.673	Smith-Magenis syndrome chromosome region, candidate 8
13	61853.ENSNLEP00000006107	0.671	RAB33B, member RAS oncogene family
14	61853.ENSNLEP00000003477	0.627	RAB34, member RAS oncogene family
15	61853.ENSNLEP00000018796	0.627	RAB36, member RAS oncogene family
16	61853.ENSNLEP00000006637	0.603	Belongs to the COG8 family.
17	61853.ENSNLEP00000014001	0.602	Rab GDP dissociation inhibitor
18	61853.ENSNLEP00000017321	0.602	Rab GDP dissociation inhibitor
19	61853.ENSNLEP00000011409	0.558	Syntaxin 16
20	61853.ENSNLEP00000006641	0.542	VPS51, GARP complex subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031267	1.000	small GTPase binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0016192	0.991	vesicle-mediated transport
GO:0016482	0.987	cytosolic transport
GO:0009894	0.986	regulation of catabolic process
GO:0042147	0.975	retrograde transport, endosome to Golgi
GO:0060255	0.961	regulation of macromolecule metabolic process
GO:0050790	0.939	regulation of catalytic activity
GO:0048519	0.939	negative regulation of biological process
GO:0009895	0.922	negative regulation of catabolic process
GO:0042176	0.920	regulation of protein catabolic process
GO:0051248	0.915	negative regulation of protein metabolic process
GO:0042177	0.866	negative regulation of protein catabolic process
GO:0043087	0.810	regulation of GTPase activity
GO:0050794	0.526	regulation of cellular process
GO:0051345	0.387	positive regulation of hydrolase activity
GO:0043547	0.371	positive regulation of GTPase activity
GO:0008152	0.304	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005886	0.998	plasma membrane
GO:0032588	0.997	trans-Golgi network membrane
GO:0140535	0.995	intracellular protein-containing complex
GO:0032045	0.993	guanyl-nucleotide exchange factor complex
GO:0034066	0.550	Ric1-Rgp1 guanyl-nucleotide exchange factor complex
GO:0005634	0.422	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]