StarFunc result for job id Q92547

User Input

>input (1522 residues)
MSRNDKEPFFVKFLKSSDNSKCFFKALESIKEFQSEEYLQIITEEEALKIKENDRSLYIC
DPFSGVVFDHLKKLGCRIVGPQVVIFCMHHQRCVPRAEHPVYNMVMSDVTISCTSLEKEK
REEVHKYVQMMGGRVYRDLNVSVTHLIAGEVGSKKYLVAANLKKPILLPSWIKTLWEKSQ
EKKITRYTDINMEDFKCPIFLGCIICVTGLCGLDRKEVQQLTVKHGGQYMGQLKMNECTH
LIVQEPKGQKYECAKRWNVHCVTTQWFFDSIEKGFCQDESIYKTEPRPEAKTMPNSSTPT
SQINTIDSRTLSDVSNISNINASCVSESICNSLNSKLEPTLENLENLDVSAFQAPEDLLD
GCRIYLCGFSGRKLDKLRRLINSGGGVRFNQLNEDVTHVIVGDYDDELKQFWNKSAHRPH
VVGAKWLLECFSKGYMLSEEPYIHANYQPVEIPVSHKPESKAALLKKKNSSFSKKDFAPS
EKHEQADEDLLSQYENGSSTVVEAKTSEARPFNDSTHAEPLNDSTHISLQEENQSSVSHC
VPDVSTITEEGLFSQKSFLVLGFSNENESNIANIIKENAGKIMSLLSRTVADYAVVPLLG
CEVEATVGEVVTNTWLVTCIDYQTLFDPKSNPLFTPVPVMTGMTPLEDCVISFSQCAGAE
KESLTFLANLLGASVQEYFVRKSNAKKGMFASTHLILKERGGSKYEAAKKWNLPAVTIAW
LLETARTGKRADESHFLIENSTKEERSLETEITNGINLNSDTAEHPGTRLQTHRKTVVTP
LDMNRFQSKAFRAVVSQHARQVAASPAVGQPLQKEPSLHLDTPSKFLSKDKLFKPSFDVK
DALAALETPGRPSQQKRKPSTPLSEVIVKNLQLALANSSRNAVALSASPQLKEAQSEKEE
APKPLHKVVVCVSKKLSKKQSELNGIAASLGADYRWSFDETVTHFIYQGRPNDTNREYKS
VKERGVHIVSEHWLLDCAQECKHLPESLYPHTYNPKMSLDISAVQDGRLCNSRLLSAVSS
TKDDEPDPLILEENDVDNMATNNKESAPSNGSGKNDSKGVLTQTLEMRENFQKQLQEIMS
ATSIVKPQGQRTSLSRSGCNSASSTPDSTRSARSGRSRVLEALRQSRQTVPDVNTEPSQN
EQIIWDDPTAREERARLASNLQWPSCPTQYSELQVDIQNLEDSPFQKPLHDSEIAKQAVC
DPGNIRVTEAPKHPISEELETPIKDSHLIPTPQAPSIAFPLANPPVAPHPREKIITIEET
HEELKKQYIFQLSSLNPQERIDYCHLIEKLGGLVIEKQCFDPTCTHIVVGHPLRNEKYLA
SVAAGKWVLHRSYLEACRTAGHFVQEEDYEWGSSSILDVLTGINVQQRRLALAAMRWRKK
IQQRQESGIVEGAFSGWKVILHVDQSREAGFKRLLQSGGAKVLPGHSVPLFKEATHLFSD
LNKLKPDDSGVNIAEAAAQNVYCLRTEYIADYLMQESPPHVENYCLPEAISFIQNNKELG
TGLSQKRKAPTEKNKIKRPRVH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6ZQF0	0.510	0.512	0.000	1515	0.769	0.772	Q6ZQF0.pdb.gz	TOPB1_MOUSE DNA topoisomerase 2-binding protein 1 OS=Mus musculus OX=10090 GN=Topbp1 PE=1 SV=2
2	AFDB:Q800K6	0.518	0.520	0.000	1513	0.631	0.635	Q800K6.pdb.gz	TOB1A_XENLA DNA topoisomerase 2-binding protein 1-A OS=Xenopus laevis OX=8355 GN=topbp1-A PE=1 SV=2
3	AFDB:Q92547	1.000	1.000	0.000	1522	1.000	1.000	Q92547.pdb.gz	TOPB1_HUMAN DNA topoisomerase 2-binding protein 1 OS=Homo sapiens OX=9606 GN=TOPBP1 PE=1 SV=3
4	AFDB:Q9VY97	0.184	0.196	2.639E-78	1425	0.218	0.233	Q9VY97.pdb.gz	Q9VY97_DROME Mutagen-sensitive 101 OS=Drosophila melanogaster OX=7227 GN=mus101 PE=1 SV=1
5	AFDB:P48754	0.124	0.106	5.645E-12	1812	0.124	0.104	P48754.pdb.gz	BRCA1_MOUSE Breast cancer type 1 susceptibility protein homolog OS=Mus musculus OX=10090 GN=Brca1 PE=1 SV=3
6	AFDB:P38398	0.116	0.097	1.057E-8	1863	0.125	0.102	P38398.pdb.gz	BRCA1_HUMAN Breast cancer type 1 susceptibility protein OS=Homo sapiens OX=9606 GN=BRCA1 PE=1 SV=2
7	AFDB:Q14676	0.122	0.091	3.643E-8	2089	0.116	0.085	Q14676.pdb.gz	MDC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3
8	AFDB:Q5PSV9	0.112	0.101	7.568E-8	1707	0.100	0.089	Q5PSV9.pdb.gz	MDC1_MOUSE Mediator of DNA damage checkpoint protein 1 OS=Mus musculus OX=10090 GN=Mdc1 PE=1 SV=1
9	AFDB:Q95RC8	0.111	0.129	1.328E-7	1280	0.095	0.113	Q95RC8.pdb.gz	Q95RC8_DROME LD44171p OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
10	PDB:7lsyY	0.072	0.106	8.563E-7	855	0.030	0.054	7lsyY.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.
11	AFDB:O96685	0.107	0.127	1.067E-5	1261	0.110	0.133	O96685.pdb.gz	O96685_DROME Mutator 2 OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
12	PDB:1sc6D	0.045	0.139	6.542E-3	384	0.014	0.057	1sc6D.pdb.gz	Multiconformational states in phosphoglycerate dehydrogenase
13	PDB:5z1zC	0.042	0.156	1.800E-2	316	0.019	0.092	5z1zC.pdb.gz
14	PDB:7ohpn	0.058	0.225	2.254E-2	314	0.021	0.102	7ohpn.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
15	PDB:4fe7A	0.046	0.137	4.185E-2	380	0.020	0.082	4fe7A.pdb.gz	Structures of the Escherichia coli transcription activator and regulator of diauxie, XylR: an AraC DNA-binding family member with a LacI/GalR ligand-binding domain.
16	PDB:3aekA	0.059	0.135	4.683E-2	415	0.022	0.082	3aekA.pdb.gz	X-ray crystal structure of the light-independent protochlorophyllide reductase
17	PDB:7p5zG	0.048	0.308	4.954E-2	213	0.011	0.080	7p5zG.pdb.gz	Structural mechanism for the selective phosphorylation of DNA-loaded MCM double hexamers by the Dbf4-dependent kinase.
18	PDB:7nacn	0.053	0.176	5.543E-2	425	0.016	0.056	7nacn.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
19	PDB:4njmA	0.049	0.161	5.864E-2	303	0.020	0.099	4njmA.pdb.gz	Crystal structures and kinetics of Type III 3-phosphoglycerate dehydrogenase reveal catalysis by lysine.
20	PDB:8dr5A	0.051	0.113	6.942E-2	646	0.018	0.042	8dr5A.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8RVN3	0.0	1462	1526	0.514	0.512	A0A2R8RVN3_DANRE DNA topoisomerase 2-binding protein 1 OS=Danio rerio OX=7955 GN=topbp1 PE=1 SV=1
2	A0A2R8YD63	0.0	3152	1517	0.996	0.999	A0A2R8YD63_HUMAN DNA topoisomerase II binding protein 1 OS=Homo sapiens OX=9606 GN=TOPBP1 PE=1 SV=1
3	F1R135	0.0	1461	1520	0.515	0.516	F1R135_DANRE DNA topoisomerase 2-binding protein 1 isoform X1 OS=Danio rerio OX=7955 GN=topbp1 PE=1 SV=1
4	Q6ZQF0	0.0	2382	1515	0.769	0.773	TOPB1_MOUSE DNA topoisomerase 2-binding protein 1 OS=Mus musculus OX=10090 GN=Topbp1 PE=1 SV=2
5	Q800K6	0.0	1929	1513	0.634	0.638	TOB1A_XENLA DNA topoisomerase 2-binding protein 1-A OS=Xenopus laevis OX=8355 GN=topbp1-A PE=1 SV=2
6	Q92547	0.0	3168	1522	1.000	1.000	TOPB1_HUMAN DNA topoisomerase 2-binding protein 1 OS=Homo sapiens OX=9606 GN=TOPBP1 PE=1 SV=3
7	Q7YU37	1.30e-65	248	1425	0.131	0.140	Q7YU37_DROME RE28166p OS=Drosophila melanogaster OX=7227 GN=mus101 PE=2 SV=1
8	Q2XXV4	1.33e-65	248	1412	0.132	0.142	Q2XXV4_DROME CG11156 (Fragment) OS=Drosophila melanogaster OX=7227 GN=mus101 PE=4 SV=1
9	Q9VY97	1.41e-65	248	1425	0.131	0.140	Q9VY97_DROME Mutagen-sensitive 101 OS=Drosophila melanogaster OX=7227 GN=mus101 PE=1 SV=1
10	Q9GTU6	1.56e-65	247	1425	0.131	0.140	Q9GTU6_DROME BRCT-domain protein MUS101 OS=Drosophila melanogaster OX=7227 GN=mus101 PE=4 SV=1
11	F4I701	2.09e-45	181	972	0.124	0.194	F4I701_ARATH Transcription coactivator OS=Arabidopsis thaliana OX=3702 GN=MEI1 PE=1 SV=1
12	Q9H8V3	3.05e-30	132	914	0.062	0.103	ECT2_HUMAN Protein ECT2 OS=Homo sapiens OX=9606 GN=ECT2 PE=1 SV=4
13	Q07139	2.72e-28	126	913	0.054	0.090	ECT2_MOUSE Protein ECT2 OS=Mus musculus OX=10090 GN=Ect2 PE=1 SV=2
14	A0A2R8Q1Z1	8.00e-27	121	980	0.045	0.070	A0A2R8Q1Z1_DANRE Epithelial cell-transforming 2 OS=Danio rerio OX=7955 GN=ect2 PE=1 SV=1
15	F1QVS6	8.75e-27	121	976	0.045	0.071	F1QVS6_DANRE Epithelial cell-transforming 2 OS=Danio rerio OX=7955 GN=ect2 PE=1 SV=1
16	Q6DRB9	1.07e-26	120	878	0.045	0.079	Q6DRB9_DANRE Epithelial cell transforming sequence 2 oncogene OS=Danio rerio OX=7955 GN=ect2 PE=1 SV=1
17	Q20129	5.60e-25	115	1182	0.055	0.071	Q20129_CAEEL BRCT domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mus-101 PE=1 SV=3
18	Q9U7D8	1.87e-19	97.4	853	0.042	0.075	Q9U7D8_DROME FI23202p1 OS=Drosophila melanogaster OX=7227 GN=pbl PE=2 SV=1
19	A8JNN0	1.88e-19	97.4	900	0.042	0.071	A8JNN0_DROME Pebble, isoform E OS=Drosophila melanogaster OX=7227 GN=pbl PE=4 SV=1
20	P32372	8.33e-17	88.6	648	0.033	0.077	RAD4_SCHPO S-M checkpoint control protein rad4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00533 BRCT	3.2e-89	304.7	BRCA1 C Terminus (BRCT) domain
2	PF16589 BRCT_2	2.9e-30	115.8	BRCT domain, a BRCA1 C-terminus domain
3	PF18428 BRCT_3	0.022	26.1	BRCA1 C Terminus (BRCT) domain
4	PF16759 LIG3_BRCT	4.6e-12	57.4	DNA ligase 3 BRCT domain
5	PF12738 PTCB-BRCT	2.1e-53	189.5	twin BRCT domain
6	PF16770 RTT107_BRCT_5	4.9e-11	53.7	Regulator of Ty1 transposition protein 107 BRCT domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260810

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000311360	0.999	Cell cycle checkpoint control protein RAD9A
2	9606.ENSP00000323099	0.999	ATR-interacting protein
3	9606.ENSP00000343741	0.999	Serine/threonine-protein kinase ATR
4	9606.ENSP00000371475	0.999	TP53-binding protein 1
5	9606.ENSP00000418960	0.999	Breast cancer type 1 susceptibility protein
6	9606.ENSP00000426191	0.999	Cell cycle checkpoint protein RAD17
7	9606.ENSP00000258774	0.998	Checkpoint protein HUS1
8	9606.ENSP00000268138	0.997	Treslin
9	9606.ENSP00000365588	0.997	Mediator of DNA damage checkpoint protein 1
10	9606.ENSP00000269305	0.996	Cellular tumor antigen p53
11	9606.ENSP00000345571	0.996	Transcription factor E2F1
12	9606.ENSP00000388648	0.996	Serine/threonine-protein kinase Chk1
13	9606.ENSP00000259008	0.994	Fanconi anemia group J protein
14	9606.ENSP00000312995	0.994	Claspin
15	9606.ENSP00000405726	0.994	Cell division control protein 45 homolog
16	9606.ENSP00000479598	0.994	RAD9, HUS1, RAD1-interacting nuclear orphan protein 1
17	9606.ENSP00000265056	0.990	DNA replication licensing factor MCM2
18	9606.ENSP00000278616	0.989	Serine-protein kinase ATM
19	9606.ENSP00000261881	0.988	TIMELESS-interacting protein
20	9606.ENSP00000376272	0.988	Replication factor C subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0019899	0.683	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071704	0.996	organic substance metabolic process
GO:0050896	0.995	response to stimulus
GO:0044238	0.995	primary metabolic process
GO:0051716	0.992	cellular response to stimulus
GO:0006950	0.987	response to stress
GO:0044260	0.986	cellular macromolecule metabolic process
GO:0090304	0.986	nucleic acid metabolic process
GO:0006974	0.984	cellular response to DNA damage stimulus
GO:0006259	0.980	DNA metabolic process
GO:0050789	0.903	regulation of biological process
GO:0050794	0.885	regulation of cellular process
GO:0009314	0.630	response to radiation
GO:0019222	0.561	regulation of metabolic process
GO:0060255	0.495	regulation of macromolecule metabolic process
GO:0080090	0.494	regulation of primary metabolic process
GO:0051171	0.493	regulation of nitrogen compound metabolic process
GO:0031323	0.492	regulation of cellular metabolic process
GO:0010212	0.473	response to ionizing radiation
GO:0071840	0.389	cellular component organization or biogenesis
GO:0019219	0.387	regulation of nucleobase-containing compound metabolic process
GO:0006281	0.380	DNA repair
GO:0007049	0.377	cell cycle
GO:0016043	0.369	cellular component organization
GO:0048519	0.367	negative regulation of biological process
GO:0048518	0.358	positive regulation of biological process
GO:0048523	0.358	negative regulation of cellular process
GO:0048522	0.341	positive regulation of cellular process
GO:0051052	0.328	regulation of DNA metabolic process
GO:0009893	0.321	positive regulation of metabolic process
GO:0051726	0.310	regulation of cell cycle
GO:0051173	0.309	positive regulation of nitrogen compound metabolic process
GO:0010604	0.304	positive regulation of macromolecule metabolic process
GO:0031325	0.303	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	0.999	nucleoplasm
GO:0016020	0.979	membrane
GO:0005694	0.941	chromosome
GO:0005886	0.922	plasma membrane
GO:0032991	0.897	protein-containing complex
GO:0005856	0.703	cytoskeleton
GO:0016604	0.687	nuclear body
GO:0005737	0.684	cytoplasm
GO:0140513	0.459	nuclear protein-containing complex
GO:0070532	0.367	BRCA1-B complex
GO:0015629	0.317	actin cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]