StarFunc result for job id Q92551

User Input

>input (441 residues)
MCVCQTMEVGQYGKNASRAGDRGVLLEPFIHQVGGHSSMMRYDDHTVCKPLISREQRFYE
SLPPEMKEFTPEYKGVVSVCFEGDSDGYINLVAYPYVESETVEQDDTTEREQPRRKHSRR
SLHRSGSGSDHKEEKASLSLETSESSQEAKSPKVELHSHSEVPFQMLDGNSGLSSEKISH
NPWSLRCHKQQLSRMRSESKDRKLYKFLLLENVVHHFKYPCVLDLKMGTRQHGDDASAEK
AARQMRKCEQSTSATLGVRVCGMQVYQLDTGHYLCRNKYYGRGLSIEGFRNALYQYLHNG
LDLRRDLFEPILSKLRGLKAVLERQASYRFYSSSLLVIYDGKECRAESCLDRRSEMRLKH
LDMVLPEVASSCGPSTSPSNTSPEAGPSSQPKVDVRMIDFAHSTFKGFRDDPTVHDGPDR
GYVFGLENLISIMEQMRDENQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R2X2	0.892	0.892	7.161E-82	441	1.000	1.000	A0A024R2X2.pdb.gz
2	AFDB:Q96PC2	0.688	0.739	1.299E-50	410	0.503	0.541	Q96PC2.pdb.gz	IP6K3_HUMAN Inositol hexakisphosphate kinase 3 OS=Homo sapiens OX=9606 GN=IP6K3 PE=1 SV=2
3	AFDB:Q8BWD2	0.694	0.771	9.361E-48	396	0.447	0.497	Q8BWD2.pdb.gz	IP6K3_MOUSE Inositol hexakisphosphate kinase 3 OS=Mus musculus OX=10090 GN=Ip6k3 PE=2 SV=1
4	AFDB:B2RCP4	0.694	0.717	1.179E-47	426	0.474	0.491	B2RCP4.pdb.gz	B2RCP4_HUMAN Kinase OS=Homo sapiens OX=9606 GN=IHPK2 PE=2 SV=1
5	AFDB:Q6PBN6	0.701	0.669	5.972E-46	463	0.456	0.434	Q6PBN6.pdb.gz	Q6PBN6_DANRE Kinase OS=Danio rerio OX=7955 GN=ihpk2 PE=2 SV=1
6	AFDB:Q80V72	0.681	0.671	1.420E-45	448	0.458	0.451	Q80V72.pdb.gz	IP6K2_MOUSE Inositol hexakisphosphate kinase 2 OS=Mus musculus OX=10090 GN=Ip6k2 PE=2 SV=2
7	AFDB:O74561	0.575	0.272	4.045E-25	967	0.306	0.140	O74561.pdb.gz	YCZ8_SCHPO Uncharacterized inositol polyphosphate kinase C970.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.08 PE=1 SV=1
8	AFDB:Q12494	0.541	0.235	7.775E-22	1050	0.274	0.115	Q12494.pdb.gz	KCS1_YEAST Inositol hexakisphosphate kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KCS1 PE=1 SV=1
9	AFDB:Q8NFU5	0.506	0.535	7.775E-22	416	0.222	0.236	Q8NFU5.pdb.gz	IPMK_HUMAN Inositol polyphosphate multikinase OS=Homo sapiens OX=9606 GN=IPMK PE=1 SV=1
10	AFDB:Q54XR3	0.534	0.339	2.613E-21	716	0.245	0.151	Q54XR3.pdb.gz	Q54XR3_DICDI Kinase OS=Dictyostelium discoideum OX=44689 GN=I6KA PE=3 SV=1
11	PDB:2iewA	0.380	0.633	1.227E-17	258	0.150	0.256	2iewA.pdb.gz	Crystal structure of inositol phosphate multikinase 2 and implications for substrate specificity.
12	PDB:4frfA	0.377	0.756	9.984E-14	214	0.113	0.234	4frfA.pdb.gz
13	PDB:1bo1A	0.191	0.245	1.601E-2	326	0.093	0.126	1bo1A.pdb.gz
14	PDB:6ym4A	0.141	0.180	9.581E-2	322	0.070	0.096	6ym4A.pdb.gz	Discovery and Characterization of the Potent and Highly Selective 1,7-Naphthyridine-Based Inhibitors BAY-091 and BAY-297 of the Kinase PIP4K2A.
15	PDB:7n81B	0.151	0.201	9.581E-2	307	0.082	0.117	7n81B.pdb.gz	Pharmacological inhibition of PI5P4K alpha / beta disrupts cell energy metabolism and selectively kills p53-null tumor cells.
16	PDB:4lv7A	0.148	0.162	2.149E-1	390	0.070	0.079	4lv7A.pdb.gz	Conformational stability of inositol 1,3,4,5,6-pentakisphosphate 2-kinase (IPK1) dictates its substrate selectivity.
17	PDB:3j79Y	0.057	0.169	3.039E-1	101	0.027	0.119	3j79Y.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
18	PDB:4v96Bd	0.069	0.151	3.220E-1	165	0.043	0.115	4v96Bd.pdb.gz
19	PDB:2lgcA	0.094	0.110	5.413E-1	359	0.036	0.045	2lgcA.pdb.gz
20	PDB:2wzpA	0.068	0.103	7.653E-1	266	0.020	0.034	2wzpA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9JNA8	0.0	548	274	0.599	0.964	C9JNA8_HUMAN Kinase OS=Homo sapiens OX=9606 GN=IP6K1 PE=1 SV=1
2	Q6PD10	0.0	860	433	0.950	0.968	IP6K1_MOUSE Inositol hexakisphosphate kinase 1 OS=Mus musculus OX=10090 GN=Ip6k1 PE=2 SV=1
3	Q92551	0.0	916	441	1.000	1.000	IP6K1_HUMAN Inositol hexakisphosphate kinase 1 OS=Homo sapiens OX=9606 GN=IP6K1 PE=1 SV=3
4	Q9ESM0	0.0	858	433	0.948	0.965	IP6K1_RAT Inositol hexakisphosphate kinase 1 OS=Rattus norvegicus OX=10116 GN=Ip6k1 PE=2 SV=1
5	Q96PC2	2.49e-142	414	410	0.499	0.537	IP6K3_HUMAN Inositol hexakisphosphate kinase 3 OS=Homo sapiens OX=9606 GN=IP6K3 PE=1 SV=2
6	B2RCP4	4.11e-134	394	426	0.478	0.495	B2RCP4_HUMAN Kinase OS=Homo sapiens OX=9606 GN=IHPK2 PE=2 SV=1
7	Q9UHH9	4.11e-134	394	426	0.478	0.495	IP6K2_HUMAN Inositol hexakisphosphate kinase 2 OS=Homo sapiens OX=9606 GN=IP6K2 PE=1 SV=2
8	Q9R0U1	5.55e-132	389	425	0.474	0.492	IP6K2_RAT Inositol hexakisphosphate kinase 2 OS=Rattus norvegicus OX=10116 GN=Ip6k2 PE=2 SV=2
9	Q80V72	8.92e-129	381	448	0.476	0.469	IP6K2_MOUSE Inositol hexakisphosphate kinase 2 OS=Mus musculus OX=10090 GN=Ip6k2 PE=2 SV=2
10	Q8BWD2	2.39e-124	368	396	0.447	0.497	IP6K3_MOUSE Inositol hexakisphosphate kinase 3 OS=Mus musculus OX=10090 GN=Ip6k3 PE=2 SV=1
11	Q6PBN6	6.19e-122	364	463	0.451	0.430	Q6PBN6_DANRE Kinase OS=Danio rerio OX=7955 GN=ihpk2 PE=2 SV=1
12	O74561	9.12e-26	112	967	0.172	0.079	YCZ8_SCHPO Uncharacterized inositol polyphosphate kinase C970.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.08 PE=1 SV=1
13	Q12494	1.98e-24	108	1050	0.136	0.057	KCS1_YEAST Inositol hexakisphosphate kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KCS1 PE=1 SV=1
14	Q99NI4	1.99e-22	100	396	0.118	0.131	IPMK_RAT Inositol polyphosphate multikinase OS=Rattus norvegicus OX=10116 GN=Ipmk PE=1 SV=1
15	Q7TT16	3.00e-22	100	396	0.116	0.129	IPMK_MOUSE Inositol polyphosphate multikinase OS=Mus musculus OX=10090 GN=Ipmk PE=1 SV=1
16	Q8NFU5	2.91e-21	97.4	416	0.111	0.118	IPMK_HUMAN Inositol polyphosphate multikinase OS=Homo sapiens OX=9606 GN=IPMK PE=1 SV=1
17	Q57X56	2.08e-19	93.2	756	0.111	0.065	Q57X56_TRYB2 Kinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.26A24.1100 PE=3 SV=1
18	Q55AP4	9.90e-17	82.8	307	0.150	0.215	Q55AP4_DICDI Kinase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271760 PE=3 SV=1
19	P07250	4.52e-16	81.6	355	0.170	0.211	IPMK_YEAST Inositol polyphosphate multikinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARG82 PE=1 SV=1
20	Q8MRX9	5.67e-15	77.8	309	0.154	0.220	Q8MRX9_DROME Kinase OS=Drosophila melanogaster OX=7227 GN=Ipk2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03770 IPK	8.3e-62	220.1	Inositol polyphosphate kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482032

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400887	0.991	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1
2	9606.ENSP00000482907	0.988	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2
3	9606.ENSP00000287996	0.970	Inositol-pentakisphosphate 2-kinase
4	9606.ENSP00000331103	0.907	Inositol hexakisphosphate kinase 2
5	9606.ENSP00000398861	0.907	Inositol hexakisphosphate kinase 3
6	9606.ENSP00000378313	0.869	Guanine nucleotide exchange factor for Rab-3A
7	9606.ENSP00000272638	0.801	UBX domain-containing protein 4
8	9606.ENSP00000361064	0.748	Multiple inositol polyphosphate phosphatase 1
9	9606.ENSP00000260386	0.715	Inositol-trisphosphate 3-kinase A
10	9606.ENSP00000328287	0.696	E3 ubiquitin-protein ligase RNF123
11	9606.ENSP00000265564	0.686	Exosome complex component RRP42
12	9606.ENSP00000296456	0.680	Acylamino-acid-releasing enzyme
13	9606.ENSP00000264864	0.668	Phosphatidylinositol 4-kinase type 2-beta
14	9606.ENSP00000411152	0.657	Inositol-trisphosphate 3-kinase B
15	9606.ENSP00000439170	0.631	Tubulin-specific chaperone E
16	9606.ENSP00000419195	0.624	CaM kinase-like vesicle-associated protein
17	9606.ENSP00000370981	0.601	Leucine zipper putative tumor suppressor 1
18	9606.ENSP00000391409	0.584	Cadherin-related family member 4
19	9606.ENSP00000362547	0.557	TELO2-interacting protein 1 homolog
20	9606.ENSP00000267615	0.553	Inositol-tetrakisphosphate 1-kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016776	1.000	phosphotransferase activity, phosphate group as acceptor
GO:0016773	1.000	phosphotransferase activity, alcohol group as acceptor
GO:0016301	1.000	kinase activity
GO:0000827	0.961	inositol-1,3,4,5,6-pentakisphosphate kinase activity
GO:0000828	0.828	inositol hexakisphosphate kinase activity
GO:0000829	0.754	inositol heptakisphosphate kinase activity
GO:0052839	0.599	inositol diphosphate tetrakisphosphate kinase activity
GO:0052836	0.599	inositol 5-diphosphate pentakisphosphate 5-kinase activity
GO:0051766	0.373	inositol trisphosphate kinase activity
GO:0008440	0.317	inositol-1,4,5-trisphosphate 3-kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0071704	0.986	organic substance metabolic process
GO:0044237	0.980	cellular metabolic process
GO:0044238	0.979	primary metabolic process
GO:0043647	0.942	inositol phosphate metabolic process
GO:0090407	0.925	organophosphate biosynthetic process
GO:0006650	0.920	glycerophospholipid metabolic process
GO:0046488	0.914	phosphatidylinositol metabolic process
GO:0006661	0.895	phosphatidylinositol biosynthetic process
GO:0065007	0.848	biological regulation
GO:0046854	0.825	phosphatidylinositol phosphate biosynthetic process
GO:0050789	0.802	regulation of biological process
GO:0050794	0.484	regulation of cellular process
GO:0019222	0.392	regulation of metabolic process
GO:0050896	0.346	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005654	0.993	nucleoplasm
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0005829	0.963	cytosol
GO:0005730	0.811	nucleolus
GO:0001650	0.747	fibrillar center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.4.-	1.000	Phosphotransferases with a phosphate group as acceptor.
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.4.21	0.961	inositol-hexakisphosphate 5-kinase.
RHEA:11020	0.317	1D-myo-inositol 1,4,5-trisphosphate + ATP = 1D-myo-inositol 1,3,4,5-tetrakisphosphate + ADP + H(+)
EC:2.7.1.127	0.317	inositol-trisphosphate 3-kinase.

[back to server]