StarFunc result for job id Q92552

User Input

>input (414 residues)
MAASIVRRGMLLARQVVLPQLSPAGKRYLLSSAYVDSHKWEAREKEHYCLADLASLMDKT
FERKLPVSSLTISRLIDNISSREEIDHAEYYLYKFRHSPNCWYLRNWTIHTWIRQCLKYD
AQDKALYTLVNKVQYGIFPDNFTFNLLMDSFIKKENYKDALSVVFEVMMQEAFEVPSTQL
LSLYVLFHCLAKKTDFSWEEERNFGASLLLPGLKQKNSVGFSSQLYGYALLGKVELQQGL
RAVYHNMPLIWKPGYLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGASEEQ
SQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLV
KEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RAJ1	0.984	0.984	3.127E-51	414	1.000	1.000	A0A024RAJ1.pdb.gz
2	AFDB:Q32PI8	0.931	0.929	5.823E-44	415	0.821	0.819	Q32PI8.pdb.gz	RT27_BOVIN Small ribosomal subunit protein mS27 OS=Bos taurus OX=9913 GN=MRPS27 PE=1 SV=1
3	AFDB:Q8BK72	0.959	0.957	2.741E-43	415	0.768	0.766	Q8BK72.pdb.gz	RT27_MOUSE Small ribosomal subunit protein mS27 OS=Mus musculus OX=10090 GN=Mrps27 PE=1 SV=2
4	PDB:7pntV	0.858	0.972	3.813E-38	365	0.708	0.803	7pntV.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
5	PDB:7l08AV	0.837	0.940	2.585E-34	367	0.884	0.997	7l08AV.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
6	PDB:6neqe	0.821	0.945	3.272E-31	358	0.742	0.858	6neqe.pdb.gz	Structure of Human Mitochondrial Translation Initiation Factor 3 Bound to the Small Ribosomal Subunit.
7	AFDB:Q8WV60	0.363	0.384	1.921E-7	388	0.140	0.149	Q8WV60.pdb.gz	PTCD2_HUMAN Pentatricopeptide repeat-containing protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD2 PE=1 SV=3
8	AFDB:Q8R3K3	0.337	0.363	7.293E-7	381	0.155	0.168	Q8R3K3.pdb.gz	PTCD2_MOUSE Pentatricopeptide repeat-containing protein 2, mitochondrial OS=Mus musculus OX=10090 GN=Ptcd2 PE=1 SV=1
9	AFDB:Q1JPP0	0.314	0.331	3.148E-4	390	0.116	0.123	Q1JPP0.pdb.gz	Q1JPP0_ARATH Adenylyl cyclase OS=Arabidopsis thaliana OX=3702 GN=DL3860C PE=1 SV=1
10	AFDB:Q9SXD8	0.240	0.169	6.267E-4	634	0.121	0.079	Q9SXD8.pdb.gz	PPR90_ARATH Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana OX=3702 GN=At1g62590 PE=2 SV=1
11	AFDB:Q9ASZ8	0.242	0.171	6.830E-4	621	0.138	0.092	Q9ASZ8.pdb.gz	PPR37_ARATH Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana OX=3702 GN=At1g12620 PE=2 SV=1
12	AFDB:F4J1L5	0.263	0.132	8.843E-4	938	0.130	0.058	F4J1L5.pdb.gz	F4J1L5_ARATH LOW protein: PPR containing-like protein OS=Arabidopsis thaliana OX=3702 GN=YS1 PE=1 SV=1
13	AFDB:Q93WC5	0.215	0.182	1.303E-3	502	0.133	0.110	Q93WC5.pdb.gz	PP300_ARATH Pentatricopeptide repeat-containing protein At4g01990, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g01990 PE=2 SV=1
14	PDB:4m57A	0.234	0.151	5.675E-3	702	0.104	0.061	4m57A.pdb.gz
15	PDB:6sgaF7	0.227	0.152	2.789E-2	662	0.123	0.077	6sgaF7.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
16	PDB:5mpbQ	0.203	0.195	6.318E-2	434	0.111	0.106	5mpbQ.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
17	PDB:6xywAO	0.216	0.201	6.595E-2	452	0.126	0.115	6xywAO.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
18	PDB:7qe7Y	0.194	0.170	7.504E-2	502	0.126	0.104	7qe7Y.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
19	PDB:6tedQ	0.169	0.094	9.715E-2	890	0.118	0.055	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
20	PDB:8a3tJ	0.180	0.152	1.059E-1	509	0.094	0.077	8a3tJ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D6RH20	0.0	622	299	0.722	1.000	D6RH20_HUMAN Mitochondrial ribosomal protein S27 (Fragment) OS=Homo sapiens OX=9606 GN=MRPS27 PE=1 SV=1
2	G5EA06	0.0	738	358	0.865	1.000	G5EA06_HUMAN Mitochondrial ribosomal protein S27 OS=Homo sapiens OX=9606 GN=MRPS27 PE=1 SV=1
3	Q32PI8	0.0	680	415	0.807	0.805	RT27_BOVIN Small ribosomal subunit protein mS27 OS=Bos taurus OX=9913 GN=MRPS27 PE=1 SV=1
4	Q8BK72	0.0	656	415	0.768	0.766	RT27_MOUSE Small ribosomal subunit protein mS27 OS=Mus musculus OX=10090 GN=Mrps27 PE=1 SV=2
5	Q92552	0.0	853	414	1.000	1.000	RT27_HUMAN Small ribosomal subunit protein mS27 OS=Homo sapiens OX=9606 GN=MRPS27 PE=1 SV=3
6	Q8WV60	9.20e-07	53.1	388	0.106	0.113	PTCD2_HUMAN Pentatricopeptide repeat-containing protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD2 PE=1 SV=3
7	Q8R3K3	1.99e-05	48.9	381	0.104	0.113	PTCD2_MOUSE Pentatricopeptide repeat-containing protein 2, mitochondrial OS=Mus musculus OX=10090 GN=Ptcd2 PE=1 SV=1
8	Q9SAB4	0.004	41.6	405	0.070	0.072	PPR33_ARATH Pentatricopeptide repeat-containing protein At1g11630, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g11630 PE=1 SV=1
9	Q0WKV3	0.010	40.4	637	0.092	0.060	PPR36_ARATH Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g12300 PE=2 SV=1
10	Q9ASZ8	0.044	38.5	621	0.070	0.047	PPR37_ARATH Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana OX=3702 GN=At1g12620 PE=2 SV=1
11	Q9LQ16	0.045	38.5	632	0.087	0.057	PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana OX=3702 GN=At1g62910 PE=2 SV=1
12	Q9LFF1	0.075	37.7	754	0.039	0.021	PP281_ARATH Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MEE40 PE=2 SV=1
13	Q9SXD1	0.12	37.0	630	0.121	0.079	PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g62670 PE=3 SV=2
14	B3KPU6	0.17	35.8	236	0.043	0.076	B3KPU6_HUMAN Pentatricopeptide repeat-containing protein 2, mitochondrial OS=Homo sapiens OX=9606 PE=1 SV=1
15	P0C894	0.22	36.2	761	0.082	0.045	PP143_ARATH Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana OX=3702 GN=At2g02150 PE=3 SV=1
16	O49436	0.32	35.8	660	0.101	0.064	PP327_ARATH Pentatricopeptide repeat-containing protein At4g20090 OS=Arabidopsis thaliana OX=3702 GN=EMB1025 PE=3 SV=1
17	Q9FMQ1	0.35	35.8	816	0.109	0.055	PP376_ARATH Pentatricopeptide repeat-containing protein At5g12100, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g12100 PE=2 SV=1
18	P0C7Q7	0.57	35.0	602	0.140	0.096	PPR38_ARATH Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g12700 PE=3 SV=1
19	F4IJS7	0.64	34.7	613	0.043	0.029	F4IJS7_ARATH Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=PPR_66 PE=1 SV=1
20	O04491	1.6	33.5	607	0.048	0.033	PPR26_ARATH Putative pentatricopeptide repeat-containing protein At1g09680 OS=Arabidopsis thaliana OX=3702 GN=At1g09680 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10037 MRP-S27	2e-157	535.8	Mitochondrial 28S ribosomal protein S27
2	PF01535 PPR	93	14.7	PPR repeat
3	PF12854 PPR_1	8.3	17.5	PPR repeat
4	PF13041 PPR_2	46	15.6	PPR repeat family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000029066

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000002422	0.993	Death associated protein 3
2	9598.ENSPTRP00000002123	0.991	Mitochondrial ribosomal protein S21
3	9598.ENSPTRP00000020929	0.991	Uncharacterized protein
4	9598.ENSPTRP00000030589	0.989	Pan troglodytes mitochondrial ribosomal protein S18B (MRPS18B), nuclear gene encoding mitochondrial protein, mRNA
5	9598.ENSPTRP00000008183	0.988	Mitochondrial ribosomal protein S35
6	9598.ENSPTRP00000040563	0.987	Pentatricopeptide repeat domain 3
7	9598.ENSPTRP00000026624	0.985	Mitochondrial ribosomal protein S22
8	9598.ENSPTRP00000009888	0.984	Mitochondrial ribosomal protein S31
9	9598.ENSPTRP00000013000	0.982	Mitochondrial ribosomal protein S34
10	9598.ENSPTRP00000000955	0.981	Mitochondrial ribosomal protein S15
11	9598.ENSPTRP00000031041	0.981	Mitochondrial ribosomal protein S10
12	9598.ENSPTRP00000022588	0.980	Mitochondrial ribosomal protein S26
13	9598.ENSPTRP00000016378	0.978	Mitochondrial ribosomal protein S7
14	9598.ENSPTRP00000016033	0.977	Mitochondrial ribosomal protein S23
15	9598.ENSPTRP00000036872	0.977	Mitochondrial ribosomal protein S2
16	9598.ENSPTRP00000000043	0.976	Aurora kinase A interacting protein 1
17	9598.ENSPTRP00000021085	0.976	Mitochondrial ribosomal protein S9
18	9598.ENSPTRP00000025285	0.976	Pan troglodytes mitochondrial ribosomal protein S25 (MRPS25), nuclear gene encoding mitochondrial protein, mRNA
19	9598.ENSPTRP00000032670	0.976	Mitochondrial ribosomal protein S24
20	9598.ENSPTRP00000002839	0.974	Mitochondrial ribosomal protein S14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.999	RNA binding
GO:0019843	0.552	rRNA binding
GO:0043021	0.536	ribonucleoprotein complex binding
GO:0043022	0.456	ribosome binding
GO:0000049	0.330	tRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0006417	0.986	regulation of translation
GO:0051247	0.985	positive regulation of protein metabolic process
GO:0045727	0.980	positive regulation of translation
GO:0062125	0.978	regulation of mitochondrial gene expression
GO:0070129	0.878	regulation of mitochondrial translation
GO:0008283	0.486	cell population proliferation
GO:0071704	0.428	organic substance metabolic process
GO:0044237	0.393	cellular metabolic process
GO:0006807	0.377	nitrogen compound metabolic process
GO:0043170	0.366	macromolecule metabolic process
GO:0034641	0.329	cellular nitrogen compound metabolic process
GO:0044238	0.303	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0070013	1.000	intracellular organelle lumen
GO:0005739	1.000	mitochondrion
GO:0016020	0.993	membrane
GO:0005634	0.991	nucleus
GO:0032991	0.988	protein-containing complex
GO:0031981	0.978	nuclear lumen
GO:0031090	0.971	organelle membrane
GO:0019866	0.959	organelle inner membrane
GO:0031966	0.958	mitochondrial membrane
GO:0005743	0.948	mitochondrial inner membrane
GO:0005759	0.919	mitochondrial matrix
GO:1990904	0.908	ribonucleoprotein complex
GO:0044391	0.903	ribosomal subunit
GO:0005761	0.903	mitochondrial ribosome
GO:0098798	0.901	mitochondrial protein-containing complex
GO:0005730	0.814	nucleolus
GO:0005654	0.306	nucleoplasm
GO:0015935	0.302	small ribosomal subunit

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]