StarFunc result for job id Q92562

User Input

>input (907 residues)
MPTAAAPIISSVQKLVLYETRARYFLVGSNNAETKYRVLKIDRTEPKDLVIIDDRHVYTQ
QEVRELLGRLDLGNRTKMGQKGSSGLFRAVSAFGVVGFVRFLEGYYIVLITKRRKMADIG
GHAIYKVEDTNMIYIPNDSVRVTHPDEARYLRIFQNVDLSSNFYFSYSYDLSHSLQYNLT
VLRMPLEMLKSEMTQNRQESFDIFEDEGLITQGGSGVFGICSEPYMKYVWNGELLDIIKS
TVHRDWLLYIIHGFCGQSKLLIYGRPVYVTLIARRSSKFAGTRFLKRGANCEGDVANEVE
TEQILCDASVMSFTAGSYSSYVQVRGSVPLYWSQDISTMMPKPPITLDQADPFAHVAALH
FDQMFQRFGSPIIILNLVKEREKRKHERILSEELVAAVTYLNQFLPPEHTIVYIPWDMAK
YTKSKLCNVLDRLNVIAESVVKKTGFFVNRPDSYCSILRPDEKWNELGGCVIPTGRLQTG
ILRTNCVDCLDRTNTAQFMVGKCALAYQLYSLGLIDKPNLQFDTDAVRLFEELYEDHGDT
LSLQYGGSQLVHRVKTYRKIAPWTQHSKDIMQTLSRYYSNAFSDADRQDSINLFLGVFHP
TEGKPHLWELPTDFYLHHKNTMRLLPTRRSYTYWWTPEVIKHLPLPYDEVICAVNLKKLI
VKKFHKYEEEIDIHNEFFRPYELSSFDDTFCLAMTSSARDFMPKTVGIDPSPFTVRKPDE
TGKSVLGNKSNREEAVLQRKTAASAPPPPSEEAVSSSSEDDSGTDREEEGSVSQRSTPVK
MTDAGDSAKVTENVVQPMKELYGINLSDGLSEEDFSIYSRFVQLGQSQHKQDKNSQQPCS
RCSDGVIKLTPISAFSQDNIYEVQPPRVDRKSTEIFQAHIQASQGIMQPLGKEDSSMYRE
YIRNRYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0Z843	0.901	0.901	0.000	907	0.939	0.939	Q0Z843.pdb.gz
2	AFDB:Q9VR06	0.672	0.710	8.165E-86	858	0.394	0.416	Q9VR06.pdb.gz	Q9VR06_DROME FIG4 phosphoinositide 5-phosphatase OS=Drosophila melanogaster OX=7227 GN=FIG4 PE=2 SV=1
3	AFDB:P42837	0.657	0.677	6.968E-70	879	0.338	0.349	P42837.pdb.gz	FIG4_YEAST Polyphosphoinositide phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FIG4 PE=1 SV=1
4	AFDB:Q7Z9H9	0.616	0.670	7.558E-68	832	0.324	0.353	Q7Z9H9.pdb.gz	FIG4_SCHPO Polyphosphoinositide phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1093.03 PE=3 SV=3
5	AFDB:Q7XZU3	0.578	0.575	5.188E-64	912	0.316	0.315	Q7XZU3.pdb.gz	SAC1_ARATH Phosphatidylinositol-3-phosphatase SAC1 OS=Arabidopsis thaliana OX=3702 GN=SAC1 PE=1 SV=1
6	AFDB:Q7XZU1	0.568	0.619	3.862E-58	831	0.290	0.316	Q7XZU1.pdb.gz	SAC4_ARATH Phosphoinositide phosphatase SAC4 OS=Arabidopsis thaliana OX=3702 GN=SAC4 PE=2 SV=1
7	PDB:7k1wF	0.447	0.842	1.080E-55	462	0.505	0.991	7k1wF.pdb.gz
8	AFDB:Q385L9	0.533	0.318	1.266E-45	1560	0.250	0.146	Q385L9.pdb.gz	Q385L9_TRYB2 Synaptojanin (N-terminal domain), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3170 PE=4 SV=1
9	AFDB:Q9EP69	0.502	0.762	6.555E-39	587	0.172	0.266	Q9EP69.pdb.gz	SAC1_MOUSE Phosphatidylinositol-3-phosphatase SAC1 OS=Mus musculus OX=10090 GN=Sacm1l PE=1 SV=1
10	AFDB:Q9W0I6	0.495	0.746	1.595E-36	592	0.163	0.250	Q9W0I6.pdb.gz	SAC1_DROME Phosphatidylinositol-3-phosphatase SAC1 OS=Drosophila melanogaster OX=7227 GN=Sac1 PE=2 SV=1
11	AFDB:Q7X911	0.495	0.743	7.606E-36	593	0.164	0.251	Q7X911.pdb.gz	SAC6_ARATH Phosphoinositide phosphatase SAC6 OS=Arabidopsis thaliana OX=3702 GN=SAC6 PE=2 SV=1
12	PDB:4tu3X	0.369	0.796	1.814E-21	400	0.115	0.260	4tu3X.pdb.gz
13	PDB:6pcvA	0.124	0.144	2.726E-3	754	0.082	0.098	6pcvA.pdb.gz
14	PDB:2esbA	0.072	0.308	6.543E-2	162	0.026	0.148	2esbA.pdb.gz
15	PDB:7st9G	0.068	0.149	1.007E-1	340	0.025	0.068	7st9G.pdb.gz	Mechanisms of loading and release of the 9-1-1 checkpoint clamp.
16	PDB:7r5jR0	0.077	0.059	1.249E-1	1399	0.074	0.048	7r5jR0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
17	PDB:2wgpA	0.068	0.285	1.318E-1	168	0.020	0.107	2wgpA.pdb.gz
18	PDB:3ggrB	0.047	0.125	2.028E-1	278	0.019	0.061	3ggrB.pdb.gz
19	PDB:1lw3A	0.109	0.168	2.259E-1	513	0.073	0.129	1lw3A.pdb.gz
20	PDB:5y15A	0.080	0.368	2.516E-1	148	0.017	0.101	5y15A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6ADY9	0.0	1704	887	0.910	0.930	A0A8I6ADY9_RAT FIG4 phosphoinositide 5-phosphatase OS=Rattus norvegicus OX=10116 GN=Fig4 PE=1 SV=1
2	Q91WF7	0.0	1781	907	0.951	0.951	FIG4_MOUSE Polyphosphoinositide phosphatase OS=Mus musculus OX=10090 GN=Fig4 PE=1 SV=1
3	Q92562	0.0	1897	907	1.000	1.000	FIG4_HUMAN Polyphosphoinositide phosphatase OS=Homo sapiens OX=9606 GN=FIG4 PE=1 SV=1
4	Q9VR06	0.0	624	858	0.406	0.429	Q9VR06_DROME FIG4 phosphoinositide 5-phosphatase OS=Drosophila melanogaster OX=7227 GN=FIG4 PE=2 SV=1
5	P42837	5.91e-168	513	879	0.327	0.338	FIG4_YEAST Polyphosphoinositide phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FIG4 PE=1 SV=1
6	Q7Z9H9	1.93e-145	453	832	0.304	0.332	FIG4_SCHPO Polyphosphoinositide phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1093.03 PE=3 SV=3
7	Q7XZU3	8.09e-144	451	912	0.278	0.276	SAC1_ARATH Phosphatidylinositol-3-phosphatase SAC1 OS=Arabidopsis thaliana OX=3702 GN=SAC1 PE=1 SV=1
8	Q7XZU1	1.94e-124	398	831	0.264	0.288	SAC4_ARATH Phosphoinositide phosphatase SAC4 OS=Arabidopsis thaliana OX=3702 GN=SAC4 PE=2 SV=1
9	Q385L9	7.02e-69	253	1560	0.213	0.124	Q385L9_TRYB2 Synaptojanin (N-terminal domain), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3170 PE=4 SV=1
10	Q96328	3.08e-48	183	588	0.171	0.264	SAC8_ARATH Phosphoinositide phosphatase SAC8 OS=Arabidopsis thaliana OX=3702 GN=SAC8 PE=2 SV=1
11	Q9EP69	4.95e-48	182	587	0.171	0.264	SAC1_MOUSE Phosphatidylinositol-3-phosphatase SAC1 OS=Mus musculus OX=10090 GN=Sacm1l PE=1 SV=1
12	Q9ES21	5.65e-48	182	587	0.170	0.262	SAC1_RAT Phosphatidylinositol-3-phosphatase SAC1 OS=Rattus norvegicus OX=10116 GN=Sacm1l PE=1 SV=1
13	Q9C5G5	8.94e-48	182	597	0.165	0.251	SAC7_ARATH Phosphoinositide phosphatase SAC7 OS=Arabidopsis thaliana OX=3702 GN=SAC7 PE=2 SV=1
14	Q7X911	8.30e-47	179	593	0.164	0.251	SAC6_ARATH Phosphoinositide phosphatase SAC6 OS=Arabidopsis thaliana OX=3702 GN=SAC6 PE=2 SV=1
15	Q9NTJ5	1.17e-46	179	587	0.162	0.250	SAC1_HUMAN Phosphatidylinositol-3-phosphatase SAC1 OS=Homo sapiens OX=9606 GN=SACM1L PE=1 SV=2
16	Q9W0I6	4.01e-46	177	592	0.168	0.257	SAC1_DROME Phosphatidylinositol-3-phosphatase SAC1 OS=Drosophila melanogaster OX=7227 GN=Sac1 PE=2 SV=1
17	Q55AW9	1.30e-45	175	581	0.170	0.265	SAC1_DICDI Phosphatidylinositol-3-phosphatase SAC1 OS=Dictyostelium discoideum OX=44689 GN=sac1 PE=3 SV=1
18	P32368	1.64e-40	161	623	0.151	0.220	SAC1_YEAST Phosphatidylinositol-3-phosphatase SAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SAC1 PE=1 SV=1
19	O60162	1.83e-37	151	598	0.154	0.234	YG23_SCHPO Uncharacterized protein C19F5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC19F5.03 PE=1 SV=1
20	Q0KI33	1.25e-35	148	1142	0.140	0.111	Q0KI33_DROME Uncharacterized protein, isoform F OS=Drosophila melanogaster OX=7227 GN=sp3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02383 Syja_N	3.5e-70	248.5	SacI homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000230124

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261776	0.999	Protein VAC14 homolog
2	9606.ENSP00000264380	0.999	1-phosphatidylinositol 3-phosphate 5-kinase
3	9606.ENSP00000345752	0.983	Myotubularin-related protein 2
4	9606.ENSP00000262039	0.973	Phosphatidylinositol 3-kinase catalytic subunit type 3
5	9606.ENSP00000359423	0.967	Myotubularin
6	9606.ENSP00000074304	0.962	Type I inositol 3,4-bisphosphate 4-phosphatase
7	9606.ENSP00000359417	0.954	Myotubularin-related protein 1
8	9606.ENSP00000371221	0.954	Myotubularin-related protein 6
9	9606.ENSP00000296003	0.950	Myotubularin-related protein 14
10	9606.ENSP00000180173	0.948	Myotubularin-related protein 7
11	9606.ENSP00000363985	0.940	Myotubularin-related protein 8
12	9606.ENSP00000425487	0.940	Type II inositol 3,4-bisphosphate 4-phosphatase
13	9606.ENSP00000325285	0.937	Myotubularin-related protein 4
14	9606.ENSP00000384651	0.936	Myotubularin-related protein 3
15	9606.ENSP00000256190	0.881	Myotubularin-related protein 13
16	9606.ENSP00000262139	0.839	WD repeat domain phosphoinositide-interacting protein 1
17	9606.ENSP00000423660	0.821	SH3 domain and tetratricopeptide repeats 2
18	9606.ENSP00000286733	0.767	N-acylethanolamine-hydrolyzing acid amidase
19	9606.ENSP00000417175	0.761	Vesicle-associated membrane protein-associated protein B/C
20	9606.ENSP00000264276	0.753	Alsin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0034596	1.000	phosphatidylinositol phosphate 4-phosphatase activity
GO:0034593	1.000	phosphatidylinositol bisphosphate phosphatase activity
GO:0004438	0.999	phosphatidylinositol-3-phosphate phosphatase activity
GO:0005515	0.977	protein binding
GO:0043812	0.921	phosphatidylinositol-4-phosphate phosphatase activity
GO:0034595	0.853	phosphatidylinositol phosphate 5-phosphatase activity
GO:0106018	0.808	phosphatidylinositol-3,5-bisphosphate phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.989	cellular metabolic process
GO:0071704	0.987	organic substance metabolic process
GO:0044238	0.986	primary metabolic process
GO:0050794	0.973	regulation of cellular process
GO:0046488	0.972	phosphatidylinositol metabolic process
GO:0048518	0.497	positive regulation of biological process
GO:0008654	0.485	phospholipid biosynthetic process
GO:0048522	0.434	positive regulation of cellular process
GO:0006661	0.410	phosphatidylinositol biosynthetic process
GO:0051128	0.334	regulation of cellular component organization
GO:0016043	0.309	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	0.999	Golgi apparatus
GO:0005768	0.999	endosome
GO:0016020	0.984	membrane
GO:0031090	0.926	organelle membrane
GO:0098588	0.872	bounding membrane of organelle
GO:0005829	0.767	cytosol
GO:0043232	0.746	intracellular non-membrane-bounded organelle
GO:0005783	0.711	endoplasmic reticulum
GO:0030659	0.710	cytoplasmic vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12316	0.999	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + phosphate
EC:3.1.3.64	0.999	phosphatidylinositol-3-phosphatase.
RHEA:55652	0.921	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + phosphate

[back to server]