StarFunc result for job id Q92570

User Input

>input (626 residues)
MPCVQAQYSPSPPGSSYAAQTYSSEYTTEIMNPDYTKLTMDLGSTEITATATTSLPSIST
FVEGYSSNYELKPSCVYQMQRPLIKVEEGRAPSYHHHHHHHHHHHHHHQQQHQQPSIPPA
SSPEDEVLPSTSMYFKQSPPSTPTTPAFPPQAGALWDEALPSAPGCIAPGPLLDPPMKAV
PTVAGARFPLFHFKPSPPHPPAPSPAGGHHLGYDPTAAAALSLPLGAAAAAGSQAAALES
HPYGLPLAKRAAPLAFPPLGLTPSPTASSLLGESPSLPSPPSRSSSSGEGTCAVCGDNAA
CQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLSVGMVKE
VVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYC
PTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVL
RLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSAL
SMITERHGLKEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQR
IFYLKLEDLVSPPSIIDKLFLDTLPF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51179	0.595	0.593	2.758E-69	628	0.930	0.927	P51179.pdb.gz	NR4A3_RAT Nuclear receptor subfamily 4 group A member 3 OS=Rattus norvegicus OX=10116 GN=Nr4a3 PE=1 SV=1
2	AFDB:F1D8N6	0.372	0.389	1.671E-44	598	0.573	0.600	F1D8N6.pdb.gz	F1D8N6_HUMAN Nuclear receptor subfamily 4 group A member 2 OS=Homo sapiens OX=9606 GN=NR4A2 PE=1 SV=1
3	AFDB:F1R8N1	0.375	0.393	1.045E-43	594	0.569	0.599	F1R8N1.pdb.gz	F1R8N1_DANRE Nuclear receptor subfamily 4 group A member 2 OS=Danio rerio OX=7955 GN=NOR1 PE=3 SV=1
4	AFDB:F1QK43	0.512	0.546	3.330E-40	586	0.534	0.570	F1QK43.pdb.gz
5	AFDB:F8W6I3	0.281	0.314	1.359E-25	553	0.417	0.472	F8W6I3.pdb.gz	F8W6I3_HUMAN Nuclear receptor subfamily 4 group A member 2 OS=Homo sapiens OX=9606 GN=NR4A2 PE=1 SV=1
6	AFDB:A0A6E1WCP9	0.325	0.395	4.237E-20	506	0.238	0.294	A0A6E1WCP9.pdb.gz	A0A6E1WCP9_HUMAN Estrogen related receptor alpha OS=Homo sapiens OX=9606 GN=ESRRA PE=1 SV=1
7	AFDB:P34021	0.427	0.313	1.318E-18	878	0.208	0.148	P34021.pdb.gz	ECR_DROME Ecdysone receptor OS=Drosophila melanogaster OX=7227 GN=EcR PE=1 SV=1
8	AFDB:H0ZRT6	0.406	0.454	3.613E-18	554	0.188	0.213	H0ZRT6.pdb.gz	H0ZRT6_TAEGU Estrogen receptor 2 OS=Taeniopygia guttata OX=59729 GN=ESR2 PE=3 SV=2
9	AFDB:H0ZLY1	0.406	0.408	1.245E-17	621	0.225	0.227	H0ZLY1.pdb.gz	H0ZLY1_TAEGU Estrogen receptor OS=Taeniopygia guttata OX=59729 GN=ESR1 PE=3 SV=2
10	AFDB:C9V3N7	0.311	0.315	6.128E-16	617	0.190	0.193	C9V3N7.pdb.gz	C9V3N7_DANRE Nuclear progesterone receptor Pgr OS=Danio rerio OX=7955 GN=pr PE=2 SV=1
11	PDB:3dzyA	0.378	0.722	1.697E-15	302	0.160	0.331	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:6fx0A	0.323	0.801	3.383E-11	238	0.099	0.261	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
13	PDB:1g2nA	0.285	0.677	3.676E-6	246	0.086	0.220	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:7kw7F	0.272	0.600	9.195E-6	259	0.065	0.158	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:7jvrR	0.095	0.158	1.987	269	0.042	0.097	7jvrR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
16	PDB:7e9gR	0.085	0.072	2.080	769	0.048	0.039	7e9gR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
17	PDB:7ohrI	0.085	0.117	2.080	409	0.054	0.083	7ohrI.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
18	PDB:1f7uA	0.089	0.091	2.280	606	0.032	0.033	1f7uA.pdb.gz	tRNA aminoacylation by arginyl-tRNA synthetase: induced conformations during substrates binding
19	PDB:7lq1A	0.076	0.056	2.280	950	0.034	0.022	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
20	PDB:7m2wG	0.093	0.085	2.280	712	0.032	0.028	7m2wG.pdb.gz	CM1-driven assembly and activation of yeast gamma-tubulin small complex underlies microtubule nucleation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R9YJF7	0.0	583	598	0.553	0.579	A0A2R9YJF7_DANRE Nuclear receptor subfamily 4 group A member 2 OS=Danio rerio OX=7955 GN=nr4a2a PE=3 SV=1
2	A9Q8C8	0.0	582	598	0.551	0.577	A9Q8C8_DANRE Nuclear receptor subfamily 4 group A member 2 OS=Danio rerio OX=7955 GN=nr4a2a PE=2 SV=1
3	F1D8N6	0.0	596	598	0.570	0.597	F1D8N6_HUMAN Nuclear receptor subfamily 4 group A member 2 OS=Homo sapiens OX=9606 GN=NR4A2 PE=1 SV=1
4	F1R8N1	0.0	551	594	0.570	0.601	F1R8N1_DANRE Nuclear receptor subfamily 4 group A member 2 OS=Danio rerio OX=7955 GN=NOR1 PE=3 SV=1
5	P43354	0.0	596	598	0.570	0.597	NR4A2_HUMAN Nuclear receptor subfamily 4 group A member 2 OS=Homo sapiens OX=9606 GN=NR4A2 PE=1 SV=1
6	P51179	0.0	980	628	0.925	0.922	NR4A3_RAT Nuclear receptor subfamily 4 group A member 3 OS=Rattus norvegicus OX=10116 GN=Nr4a3 PE=1 SV=1
7	Q06219	0.0	596	598	0.569	0.595	NR4A2_MOUSE Nuclear receptor subfamily 4 group A member 2 OS=Mus musculus OX=10090 GN=Nr4a2 PE=1 SV=1
8	Q07917	0.0	593	598	0.567	0.594	NR4A2_RAT Nuclear receptor subfamily 4 group A member 2 OS=Rattus norvegicus OX=10116 GN=Nr4a2 PE=1 SV=3
9	Q6DH08	0.0	580	586	0.542	0.578	Q6DH08_DANRE Nuclear receptor subfamily 4 group A member 2 OS=Danio rerio OX=7955 GN=nurr1 PE=2 SV=1
10	Q92570	0.0	1284	626	1.000	1.000	NR4A3_HUMAN Nuclear receptor subfamily 4 group A member 3 OS=Homo sapiens OX=9606 GN=NR4A3 PE=1 SV=3
11	Q9QZB6	0.0	980	627	0.922	0.920	NR4A3_MOUSE Nuclear receptor subfamily 4 group A member 3 OS=Mus musculus OX=10090 GN=Nr4a3 PE=1 SV=1
12	P22736	1.56e-162	480	598	0.497	0.520	NR4A1_HUMAN Nuclear receptor subfamily 4immunitygroup A member 1 OS=Homo sapiens OX=9606 GN=NR4A1 PE=1 SV=1
13	F5GXF0	8.67e-162	480	652	0.497	0.477	F5GXF0_HUMAN Nuclear receptor subfamily 4 group A member 1 OS=Homo sapiens OX=9606 GN=NR4A1 PE=1 SV=1
14	P12813	1.45e-157	467	601	0.478	0.498	NR4A1_MOUSE Nuclear receptor subfamily 4 group A member 1 OS=Mus musculus OX=10090 GN=Nr4a1 PE=1 SV=1
15	P22829	2.35e-155	461	597	0.482	0.506	NR4A1_RAT Nuclear receptor subfamily 4 group A member 1 OS=Rattus norvegicus OX=10116 GN=Nr4a1 PE=1 SV=2
16	P49869	7.07e-134	420	1073	0.342	0.199	HR38_DROME Probable nuclear hormone receptor HR38 OS=Drosophila melanogaster OX=7227 GN=Hr38 PE=1 SV=3
17	F8W6I3	1.08e-131	399	553	0.430	0.486	F8W6I3_HUMAN Nuclear receptor subfamily 4 group A member 2 OS=Homo sapiens OX=9606 GN=NR4A2 PE=1 SV=1
18	P22448	3.49e-53	191	455	0.185	0.255	RARB_CHICK Retinoic acid receptor beta OS=Gallus gallus OX=9031 GN=RARB PE=2 SV=2
19	A0A8I6A7Z0	5.81e-53	190	455	0.214	0.295	A0A8I6A7Z0_RAT Retinoic acid receptor, beta OS=Rattus norvegicus OX=10116 GN=Rarb PE=3 SV=1
20	P22605	2.05e-52	189	482	0.185	0.241	RARB_MOUSE Retinoic acid receptor beta OS=Mus musculus OX=10090 GN=Rarb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	2.4e-17	74.8	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	1.4e-27	107.3	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482027

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300305	0.903	Runt-related transcription factor 1
2	9606.ENSP00000415151	0.900	Core-binding factor subunit beta
3	9606.ENSP00000388940	0.824	Transcription factor 12
4	9606.ENSP00000260653	0.797	Homeobox protein SIX3
5	9606.ENSP00000259400	0.770	Syntaxin-17
6	9606.ENSP00000474096	0.764	TATA-binding protein-associated factor 2N
7	9606.ENSP00000355759	0.724	Poly [ADP-ribose] polymerase 1
8	9606.ENSP00000240851	0.720	Protein TFG
9	9606.ENSP00000254108	0.720	RNA-binding protein FUS
10	9606.ENSP00000306245	0.685	Proto-oncogene c-Fos
11	9606.ENSP00000245919	0.659	Protein fosB
12	9606.ENSP00000400142	0.643	RNA-binding protein EWS
13	9606.ENSP00000242480	0.595	E3 SUMO-protein ligase EGR2
14	9606.ENSP00000244520	0.576	U1 small nuclear ribonucleoprotein C
15	9606.ENSP00000239938	0.559	Early growth response protein 1
16	9606.ENSP00000264716	0.557	Fos-related antigen 2
17	9606.ENSP00000451605	0.556	Melanocyte-stimulating hormone receptor
18	9606.ENSP00000263734	0.549	Endothelial PAS domain-containing protein 1
19	9606.ENSP00000318057	0.544	Early growth response protein 3
20	9606.ENSP00000344352	0.544	Cyclic AMP-dependent transcription factor ATF-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003677	1.000	DNA binding
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0008134	0.999	transcription factor binding
GO:0019899	0.997	enzyme binding
GO:0060089	0.994	molecular transducer activity
GO:0043565	0.961	sequence-specific DNA binding
GO:0140297	0.944	DNA-binding transcription factor binding
GO:0003690	0.939	double-stranded DNA binding
GO:1990837	0.898	sequence-specific double-stranded DNA binding
GO:0061629	0.894	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0042802	0.889	identical protein binding
GO:0046983	0.877	protein dimerization activity
GO:0016922	0.867	nuclear receptor binding
GO:0038023	0.845	signaling receptor activity
GO:0035259	0.828	nuclear glucocorticoid receptor binding
GO:0000976	0.817	transcription cis-regulatory region binding
GO:0042803	0.756	protein homodimerization activity
GO:0098531	0.727	ligand-activated transcription factor activity
GO:0000977	0.574	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.490	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.479	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0004879	0.445	nuclear receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0048518	0.988	positive regulation of biological process
GO:0019222	0.985	regulation of metabolic process
GO:0048522	0.977	positive regulation of cellular process
GO:0009893	0.975	positive regulation of metabolic process
GO:0006355	0.975	regulation of DNA-templated transcription
GO:0006357	0.973	regulation of transcription by RNA polymerase II
GO:0009891	0.957	positive regulation of biosynthetic process
GO:0050896	0.920	response to stimulus
GO:0051254	0.917	positive regulation of RNA metabolic process
GO:0045893	0.912	positive regulation of DNA-templated transcription
GO:0045944	0.878	positive regulation of transcription by RNA polymerase II
GO:0051716	0.838	cellular response to stimulus
GO:0032502	0.733	developmental process
GO:0048856	0.712	anatomical structure development
GO:0048519	0.639	negative regulation of biological process
GO:0023052	0.575	signaling
GO:0007154	0.570	cell communication
GO:0032501	0.568	multicellular organismal process
GO:0048523	0.568	negative regulation of cellular process
GO:0007275	0.452	multicellular organism development
GO:0007165	0.435	signal transduction
GO:0008152	0.417	metabolic process
GO:0009892	0.416	negative regulation of metabolic process
GO:0048731	0.384	system development
GO:0010605	0.367	negative regulation of macromolecule metabolic process
GO:0031324	0.361	negative regulation of cellular metabolic process
GO:0051172	0.356	negative regulation of nitrogen compound metabolic process
GO:0048583	0.349	regulation of response to stimulus
GO:0045934	0.346	negative regulation of nucleobase-containing compound metabolic process
GO:0071704	0.331	organic substance metabolic process
GO:0051253	0.312	negative regulation of RNA metabolic process
GO:0031327	0.307	negative regulation of cellular biosynthetic process
GO:0042221	0.304	response to chemical
GO:0010558	0.302	negative regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0032991	0.989	protein-containing complex
GO:0005667	0.952	transcription regulator complex
GO:0005737	0.654	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]