StarFunc result for job id Q92574

User Input

>input (1164 residues)
MAQQANVGELLAMLDSPMLGVRDDVTAVFKENLNSDRGPMLVNTLVDYYLETSSQPALHI
LTTLQEPHDKHLLDRINEYVGKAATRLSILSLLGHVIRLQPSWKHKLSQAPLLPSLLKCL
KMDTDVVVLTTGVLVLITMLPMIPQSGKQHLLDFFDIFGRLSSWCLKKPGHVAEVYLVHL
HASVYALFHRLYGMYPCNFVSFLRSHYSMKENLETFEEVVKPMMEHVRIHPELVTGSKDH
ELDPRRWKRLETHDVVIECAKISLDPTEASYEDGYSVSHQISARFPHRSADVTTSPYADT
QNSYGCATSTPYSTSRLMLLNMPGQLPQTLSSPSTRLITEPPQATLWSPSMVCGMTTPPT
SPGNVPPDLSHPYSKVFGTTAGGKGTPLGTPATSPPPAPLCHSDDYVHISLPQATVTPPR
KEERMDSARPCLHRQHHLLNDRGSEEPPGSKGSVTLSDLPGFLGDLASEEDSIEKDKEEA
AISRELSEITTAEAEPVVPRGGFDSPFYRDSLPGSQRKTHSAASSSQGASVNPEPLHSSL
DKLGPDTPKQAFTPIDLPCGSADESPAGDRECQTSLETSIFTPSPCKIPPPTRVGFGSGQ
PPPYDHLFEVALPKTAHHFVIRKTEELLKKAKGNTEEDGVPSTSPMEVLDRLIQQGADAH
SKELNKLPLPSKSVDWTHFGGSPPSDEIRTLRDQLLLLHNQLLYERFKRQQHALRNRRLL
RKVIKAAALEEHNAAMKDQLKLQEKDIQMWKVSLQKEQARYNQLQEQRDTMVTKLHSQIR
QLQHDREEFYNQSQELQTKLEDCRNMIAELRIELKKANNKVCHTELLLSQVSQKLSNSES
VQQQMEFLNRQLLVLGEVNELYLEQLQNKHSDTTKEVEMMKAAYRKELEKNRSHVLQQTQ
RLDTSQKRILELESHLAKKDHLLLEQKKYLEDVKLQARGQLQAAESRYEAQKRITQVFEL
EILDLYGRLEKDGLLKKLEEEKAEAAEAAEERLDCCNDGCSDSMVGHNEEASGHNGETKT
PRPSSARGSSGSRGGGGSSSSSSELSTPEKPPHQRAGPFSSRWETTMGEASASIPTTVGS
LPSSKSFLGMKARELFRNKSESQCDEDGMTSSLSESLKTELGKDLGVEAKIPLNLDGPHP
SPPTPDSVGQLHIMDYNETHHEHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92574	1.000	1.000	0.000	1164	1.000	1.000	Q92574.pdb.gz	TSC1_HUMAN Hamartin OS=Homo sapiens OX=9606 GN=TSC1 PE=1 SV=2
2	AFDB:Q9U9A9	0.216	0.228	3.054E-26	1100	0.206	0.218	Q9U9A9.pdb.gz	Q9U9A9_DROME Tuberous sclerosis gene product-1 homolog OS=Drosophila melanogaster OX=7227 GN=Tsc1 PE=2 SV=1
3	AFDB:A1Z7Z9	0.092	0.094	5.946E-4	1134	0.104	0.107	A1Z7Z9.pdb.gz	CP131_DROME Centrosomal protein of 131 kDa OS=Drosophila melanogaster OX=7227 GN=dila PE=2 SV=2
4	AFDB:Q0VF96	0.129	0.117	7.572E-4	1302	0.119	0.106	Q0VF96.pdb.gz	CGNL1_HUMAN Cingulin-like protein 1 OS=Homo sapiens OX=9606 GN=CGNL1 PE=1 SV=2
5	AFDB:U3JAG9	0.103	0.107	1.723E-3	1113	0.081	0.084	U3JAG9.pdb.gz	CP131_DANRE Centrosomal protein of 131 kDa OS=Danio rerio OX=7955 GN=cep131 PE=1 SV=1
6	AFDB:Q96GE4	0.076	0.104	1.898E-3	821	0.109	0.155	Q96GE4.pdb.gz	CEP95_HUMAN Centrosomal protein of 95 kDa OS=Homo sapiens OX=9606 GN=CEP95 PE=1 SV=1
7	PDB:7mqaLM	0.106	0.065	2.671E-3	2041	0.027	0.015	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
8	AFDB:Q811D2	0.106	0.085	5.775E-3	1581	0.135	0.099	Q811D2.pdb.gz	ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus OX=10090 GN=Ankrd26 PE=1 SV=2
9	AFDB:Q09228	0.053	0.055	6.061E-3	1129	0.093	0.096	Q09228.pdb.gz	EGL27_CAEEL Egg-laying defective protein 27 OS=Caenorhabditis elegans OX=6239 GN=egl-27 PE=1 SV=2
10	PDB:4ct7B	0.105	0.334	6.379E-3	269	0.031	0.134	4ct7B.pdb.gz	Structural and Biochemical Insights to the Role of the Ccr4-not Complex and Ddx6 ATPase in Microrna Repression.
11	PDB:7nscE	0.119	0.199	6.379E-3	615	0.034	0.065	7nscE.pdb.gz
12	AFDB:Q8I3S3	0.105	0.071	7.008E-3	1894	0.093	0.057	Q8I3S3.pdb.gz	Q8I3S3_PLAF7 mRNA-binding protein PUF1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0518700 PE=4 SV=1
13	AFDB:P53352	0.051	0.064	8.504E-3	877	0.099	0.131	P53352.pdb.gz	INCE_CHICK Inner centromere protein OS=Gallus gallus OX=9031 GN=INCENP PE=1 SV=1
14	PDB:7unkA	0.111	0.120	1.256E-2	1047	0.033	0.036	7unkA.pdb.gz
15	PDB:2z6gA	0.122	0.235	1.383E-2	550	0.034	0.071	2z6gA.pdb.gz
16	PDB:6kbnC	0.134	0.275	1.599E-2	504	0.031	0.071	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
17	PDB:4jlqA	0.100	0.127	1.762E-2	840	0.045	0.062	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
18	PDB:4a3tB	0.065	0.131	2.999E-2	459	0.035	0.089	4a3tB.pdb.gz
19	PDB:3zhpA	0.126	0.342	3.304E-2	315	0.027	0.098	3zhpA.pdb.gz
20	PDB:6n1zA	0.137	0.162	3.468E-2	961	0.032	0.039	6n1zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y5N2	0.0	2384	1159	0.996	1.000	A0A2R8Y5N2_HUMAN TSC complex subunit 1 OS=Homo sapiens OX=9606 GN=TSC1 PE=1 SV=1
2	A0A2R8Y5S3	0.0	2391	1163	0.999	1.000	A0A2R8Y5S3_HUMAN TSC complex subunit 1 OS=Homo sapiens OX=9606 GN=TSC1 PE=1 SV=1
3	A0A2R8Y6S1	0.0	1479	729	0.626	1.000	A0A2R8Y6S1_HUMAN TSC complex subunit 1 (Fragment) OS=Homo sapiens OX=9606 GN=TSC1 PE=1 SV=1
4	A0A2R8YFV7	0.0	2377	1158	0.995	1.000	A0A2R8YFV7_HUMAN TSC complex subunit 1 OS=Homo sapiens OX=9606 GN=TSC1 PE=1 SV=1
5	Q86WV8	0.0	691	366	0.297	0.945	Q86WV8_HUMAN TSC complex subunit 1 OS=Homo sapiens OX=9606 GN=TSC1 PE=1 SV=1
6	Q92574	0.0	2398	1164	1.000	1.000	TSC1_HUMAN Hamartin OS=Homo sapiens OX=9606 GN=TSC1 PE=1 SV=2
7	Q9EP53	0.0	1921	1161	0.873	0.875	TSC1_MOUSE Hamartin OS=Mus musculus OX=10090 GN=Tsc1 PE=1 SV=1
8	Q9Z136	0.0	1876	1163	0.864	0.865	TSC1_RAT Hamartin OS=Rattus norvegicus OX=10116 GN=Tsc1 PE=1 SV=1
9	X5D9D2	0.0	2398	1164	1.000	1.000	X5D9D2_HUMAN Tuberous sclerosis 1 isoform A (Fragment) OS=Homo sapiens OX=9606 GN=TSC1 PE=2 SV=1
10	Q7SXZ2	5.76e-128	422	1128	0.178	0.184	Q7SXZ2_DANRE Hamartin OS=Danio rerio OX=7955 GN=fa99f04 PE=1 SV=1
11	Q9VCC9	7.58e-51	198	1100	0.082	0.086	Q9VCC9_DROME LD23779p OS=Drosophila melanogaster OX=7227 GN=Tsc1 PE=2 SV=1
12	Q9U9A9	7.78e-51	198	1100	0.082	0.086	Q9U9A9_DROME Tuberous sclerosis gene product-1 homolog OS=Drosophila melanogaster OX=7227 GN=Tsc1 PE=2 SV=1
13	Q09778	3.31e-07	57.4	899	0.058	0.075	TSC1_SCHPO Tuberous sclerosis 1 protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tsc1 PE=1 SV=1
14	Q9D4H4	0.065	40.0	968	0.052	0.062	AMOL1_MOUSE Angiomotin-like protein 1 OS=Mus musculus OX=10090 GN=Amotl1 PE=1 SV=2
15	Q80Y83	0.066	39.7	711	0.028	0.046	DIXC1_MOUSE Dixin OS=Mus musculus OX=10090 GN=Dixdc1 PE=1 SV=1
16	H9FWV3	0.075	39.7	1311	0.034	0.030	H9FWV3_MACMU Neurabin-1 isoform 1 OS=Macaca mulatta OX=9544 GN=PPP1R9A PE=2 SV=1
17	Q19124	0.096	39.3	527	0.023	0.051	A16L1_CAEEL Autophagic-related protein 16.1 OS=Caenorhabditis elegans OX=6239 GN=atg-16.1 PE=1 SV=2
18	Q9UBC2	0.16	38.5	864	0.043	0.058	EP15R_HUMAN Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1
19	P25391	0.21	38.5	3075	0.044	0.017	LAMA1_HUMAN Laminin subunit alpha-1 OS=Homo sapiens OX=9606 GN=LAMA1 PE=1 SV=2
20	B7ZC06	0.23	38.1	997	0.040	0.047	B7ZC06_HUMAN Golgin A2 OS=Homo sapiens OX=9606 GN=GOLGA2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04388 Hamartin	1.4e-294	991.2	Hamartin protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000298552

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219476	0.999	Tuberin
2	9606.ENSP00000262187	0.999	GTP-binding protein Rheb
3	9606.ENSP00000475727	0.999	TBC1 domain family member 7
4	9606.ENSP00000451828	0.997	RAC-alpha serine/threonine-protein kinase
5	9606.ENSP00000307272	0.989	Regulatory-associated protein of mTOR
6	9606.ENSP00000354558	0.989	Serine/threonine-protein kinase mTOR
7	9606.ENSP00000296782	0.984	Rapamycin-insensitive companion of mTOR
8	9606.ENSP00000264335	0.975	14-3-3 protein epsilon
9	9606.ENSP00000307305	0.975	DNA damage-inducible transcript 4 protein
10	9606.ENSP00000456405	0.973	Target of rapamycin complex subunit LST8
11	9606.ENSP00000435412	0.972	Ribosomal protein S6 kinase alpha-1
12	9606.ENSP00000369899	0.971	Ras-related GTP-binding protein A
13	9606.ENSP00000362092	0.969	Ras-related GTP-binding protein C
14	9606.ENSP00000361930	0.966	14-3-3 protein beta/alpha
15	9606.ENSP00000262850	0.964	Ras-related GTP-binding protein B
16	9606.ENSP00000375892	0.964	RAC-beta serine/threonine-protein kinase
17	9606.ENSP00000324806	0.963	Glycogen synthase kinase-3 beta
18	9606.ENSP00000286234	0.958	DEP domain-containing mTOR-interacting protein
19	9606.ENSP00000265960	0.953	Target of rapamycin complex 2 subunit MAPKAP1
20	9606.ENSP00000248975	0.952	14-3-3 protein eta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0060590	0.995	ATPase regulator activity
GO:0042030	0.994	ATPase inhibitor activity
GO:0031072	0.911	heat shock protein binding
GO:0030544	0.895	Hsp70 protein binding
GO:0051879	0.891	Hsp90 protein binding
GO:0051087	0.863	chaperone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.999	biological regulation
GO:0009987	0.992	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0050896	0.983	response to stimulus
GO:0048518	0.977	positive regulation of biological process
GO:0031323	0.975	regulation of cellular metabolic process
GO:0048522	0.973	positive regulation of cellular process
GO:0050790	0.972	regulation of catalytic activity
GO:0048519	0.965	negative regulation of biological process
GO:0048523	0.964	negative regulation of cellular process
GO:0060255	0.953	regulation of macromolecule metabolic process
GO:1902531	0.949	regulation of intracellular signal transduction
GO:0051171	0.948	regulation of nitrogen compound metabolic process
GO:0080090	0.947	regulation of primary metabolic process
GO:0071840	0.896	cellular component organization or biogenesis
GO:0051246	0.885	regulation of protein metabolic process
GO:0051128	0.882	regulation of cellular component organization
GO:0051179	0.863	localization
GO:0031399	0.807	regulation of protein modification process
GO:0051716	0.741	cellular response to stimulus
GO:0019220	0.739	regulation of phosphate metabolic process
GO:0042221	0.735	response to chemical
GO:0009892	0.697	negative regulation of metabolic process
GO:0032006	0.692	regulation of TOR signaling
GO:0031324	0.669	negative regulation of cellular metabolic process
GO:0065008	0.658	regulation of biological quality
GO:0010033	0.641	response to organic substance
GO:0009893	0.562	positive regulation of metabolic process
GO:0009889	0.540	regulation of biosynthetic process
GO:0010556	0.526	regulation of macromolecule biosynthetic process
GO:0044093	0.525	positive regulation of molecular function
GO:0031326	0.481	regulation of cellular biosynthetic process
GO:0016043	0.471	cellular component organization
GO:0043085	0.465	positive regulation of catalytic activity
GO:0032501	0.455	multicellular organismal process
GO:0007154	0.455	cell communication
GO:0042127	0.451	regulation of cell population proliferation
GO:0010468	0.444	regulation of gene expression
GO:0048585	0.439	negative regulation of response to stimulus
GO:0023057	0.432	negative regulation of signaling
GO:0010648	0.432	negative regulation of cell communication
GO:0009968	0.413	negative regulation of signal transduction
GO:0044092	0.401	negative regulation of molecular function
GO:0031325	0.395	positive regulation of cellular metabolic process
GO:0008152	0.384	metabolic process
GO:1901700	0.364	response to oxygen-containing compound
GO:0033043	0.357	regulation of organelle organization
GO:0044237	0.351	cellular metabolic process
GO:0051172	0.341	negative regulation of nitrogen compound metabolic process
GO:0051234	0.335	establishment of localization
GO:0006950	0.326	response to stress
GO:0010605	0.323	negative regulation of macromolecule metabolic process
GO:1901698	0.322	response to nitrogen compound
GO:0051641	0.314	cellular localization
GO:1902532	0.312	negative regulation of intracellular signal transduction
GO:0023052	0.311	signaling
GO:0010243	0.305	response to organonitrogen compound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0005811	0.974	lipid droplet
GO:0032991	0.942	protein-containing complex
GO:0043227	0.751	membrane-bounded organelle
GO:0043231	0.691	intracellular membrane-bounded organelle
GO:0042995	0.386	cell projection
GO:0120025	0.384	plasma membrane bounded cell projection
GO:0101031	0.384	chaperone complex
GO:0099513	0.379	polymeric cytoskeletal fiber
GO:0005634	0.375	nucleus
GO:0033596	0.370	TSC1-TSC2 complex
GO:0005884	0.365	actin filament
GO:0030027	0.362	lamellipodium
GO:0005938	0.361	cell cortex
GO:0016020	0.329	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]