StarFunc result for job id Q92576

User Input

>input (2039 residues)
MDIVDTFNHLIPTEHLDDALFLGSNLENEVCEDFSASQNVLEDSLKNMLSDKDPMLGSAS
NQFCLPVLDSNDPNFQMPCSTVVGLDDIMDEGVVKESGNDTIDEEELILPNRNLRDKVEE
NSVRSPRKSPRLMAQEQVRSLRQSTIAKRSNAAPLSNTKKASGKTVSTAKAGVKQPERSQ
VKEEVCMSLKPEYHKENRRCSRNSGQIEVVPEVSVSSSHSSVSSCLEMKDEDGLDSKHKC
NNPGEIDVPSHELNCSLLSETCVTIGEKKNEALMECKAKPVGSPLFKFSDKEEHEQNDSI
SGKTGETVVEEMIATRKVEQDSKETVKLSHEDDHILEDAGSSDISSDAACTNPNKTENSL
VGLPSCVDEVTECNLELKDTMGIADKTENTLERNKIEPLGYCEDAESNRQLESTEFNKSN
LEVVDTSTFGPESNILENAICDVPDQNSKQLNAIESTKIESHETANLQDDRNSQSSSVSY
LESKSVKSKHTKPVIHSKQNMTTDAPKKIVAAKYEVIHSKTKVNVKSVKRNTDVPESQQN
FHRPVKVRKKQIDKEPKIQSCNSGVKSVKNQAHSVLKKTLQDQTLVQIFKPLTHSLSDKS
HAHPGCLKEPHHPAQTGHVSHSSQKQCHKPQQQAPAMKTNSHVKEELEHPGVEHFKEEDK
LKLKKPEKNLQPRQRRSSKSFSLDEPPLFIPDNIATIRREGSDHSSSFESKYMWTPSKQC
GFCKKPHGNRFMVGCGRCDDWFHGDCVGLSLSQAQQMGEEDKEYVCVKCCAEEDKKTEIL
DPDTLENQATVEFHSGDKTMECEKLGLSKHTTNDRTKYIDDTVKHKVKILKRESGEGRNS
SDCRDNEIKKWQLAPLRKMGQPVLPRRSSEEKSEKIPKESTTVTCTGEKASKPGTHEKQE
MKKKKVEKGVLNVHPAASASKPSADQIRQSVRHSLKDILMKRLTDSNLKVPEEKAAKVAT
KIEKELFSFFRDTDAKYKNKYRSLMFNLKDPKNNILFKKVLKGEVTPDHLIRMSPEELAS
KELAAWRRRENRHTIEMIEKEQREVERRPITKITHKGEIEIESDAPMKEQEAAMEIQEPA
ANKSLEKPEGSEKQKEEVDSMSKDTTSQHRQHLFDLNCKICIGRMAPPVDDLSPKKVKVV
VGVARKHSDNEAESIADALSSTSNILASEFFEEEKQESPKSTFSPAPRPEMPGTVEVEST
FLARLNFIWKGFINMPSVAKFVTKAYPVSGSPEYLTEDLPDSIQVGGRISPQTVWDYVEK
IKASGTKEICVVRFTPVTEEDQISYTLLFAYFSSRKRYGVAANNMKQVKDMYLIPLGATD
KIPHPLVPFDGPGLELHRPNLLLGLIIRQKLKRQHSACASTSHIAETPESAPPIALPPDK
KSKIEVSTEEAPEEENDFFNSFTTVLHKQRNKPQQNLQEDLPTAVEPLMEVTKQEPPKPL
RFLPGVLIGWENQPTTLELANKPLPVDDILQSLLGTTGQVYDQAQSVMEQNTVKEIPFLN
EQTNSKIEKTDNVEVTDGENKEIKVKVDNISESTDKSAEIETSVVGSSSISAGSLTSLSL
RGKPPDVSTEAFLTNLSIQSKQEETVESKEKTLKRQLQEDQENNLQDNQTSNSSPCRSNV
GKGNIDGNVSCSENLVANTARSPQFINLKRDPRQAAGRSQPVTTSESKDGDSCRNGEKHM
LPGLSHNKEHLTEQINVEEKLCSAEKNSCVQQSDNLKVAQNSPSVENIQTSQAEQAKPLQ
EDILMQNIETVHPFRRGSAVATSHFEVGNTCPSEFPSKSITFTSRSTSPRTSTNFSPMRP
QQPNLQHLKSSPPGFPFPGPPNFPPQSMFGFPPHLPPPLLPPPGFGFAQNPMVPWPPVVH
LPGQPQRMMGPLSQASRYIGPQNFYQVKDIRRPERRHSDPWGRQDQQQLDRPFNRGKGDR
QRFYSDSHHLKRERHEKEWEQESERHRRRDRSQDKDRDRKSREEGHKDKERARLSHGDRG
TDGKASRDSRNVDKKPDKPKSEDYEKDKEREKSKHREGEKDRDRYHKDRDHTDRTKSKR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BTC0	0.086	0.078	8.397E-47	2240	0.213	0.194	Q9BTC0.pdb.gz	DIDO1_HUMAN Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5
2	AFDB:Q8C9B9	0.082	0.074	4.262E-44	2256	0.206	0.187	Q8C9B9.pdb.gz	DIDO1_MOUSE Death-inducer obliterator 1 OS=Mus musculus OX=10090 GN=Dido1 PE=1 SV=4
3	AFDB:Q4JK59	0.036	0.037	8.386E-9	1912	0.125	0.133	Q4JK59.pdb.gz	TET2_MOUSE Methylcytosine dioxygenase TET2 OS=Mus musculus OX=10090 GN=Tet2 PE=1 SV=3
4	AFDB:D4AC33	0.039	0.041	6.689E-8	1920	0.111	0.118	D4AC33.pdb.gz	D4AC33_RAT Methylcytosine dioxygenase TET OS=Rattus norvegicus OX=10116 GN=Tet2 PE=3 SV=2
5	AFDB:M9PHU0	0.043	0.041	3.597E-6	2263	0.116	0.104	M9PHU0.pdb.gz	M9PHU0_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG12432 PE=1 SV=1
6	PDB:5iy6U	0.049	0.520	1.393E-5	170	0.020	0.241	5iy6U.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
7	AFDB:M9NFI9	0.033	0.032	5.320E-5	2148	0.119	0.113	M9NFI9.pdb.gz	M9NFI9_DROME Spinophilin, isoform J OS=Drosophila melanogaster OX=7227 GN=Spn PE=1 SV=1
8	AFDB:Q3LHL9	0.036	0.040	8.335E-5	1658	0.099	0.122	Q3LHL9.pdb.gz	WGE_DROME Protein winged eye OS=Drosophila melanogaster OX=7227 GN=wge PE=1 SV=1
9	AFDB:Q9VW85	0.043	0.048	3.031E-4	1661	0.105	0.129	Q9VW85.pdb.gz	Q9VW85_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG13812 PE=1 SV=4
10	AFDB:Q7Z3T8	0.036	0.044	5.022E-4	1539	0.072	0.095	Q7Z3T8.pdb.gz	ZFY16_HUMAN Zinc finger FYVE domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZFYVE16 PE=1 SV=3
11	AFDB:Q68FD9	0.030	0.031	5.312E-4	1940	0.116	0.122	Q68FD9.pdb.gz	K1549_MOUSE UPF0606 protein KIAA1549 OS=Mus musculus OX=10090 GN=Kiaa1549 PE=1 SV=3
12	PDB:5y58A	0.051	0.174	5.974E-3	548	0.010	0.038	5y58A.pdb.gz	Structural Insights into Yeast Telomerase Recruitment to Telomeres
13	PDB:6sn1B	0.045	0.158	3.403E-2	503	0.008	0.032	6sn1B.pdb.gz
14	PDB:7nfcC	0.044	0.166	3.807E-2	477	0.010	0.042	7nfcC.pdb.gz	Cryo-EM of NHEJ supercomplexes provides insights into DNA repair.
15	PDB:5z8lA	0.022	0.213	6.673E-2	204	0.009	0.088	5z8lA.pdb.gz	EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
16	PDB:1jeqA	0.042	0.135	1.384E-1	548	0.004	0.016	1jeqA.pdb.gz
17	PDB:7k0yC	0.045	0.128	1.549E-1	655	0.009	0.029	7k0yC.pdb.gz	Structure of an activated DNA-PK and its implications for NHEJ.
18	PDB:5iv5BE	0.028	0.200	2.050E-1	165	0.009	0.109	5iv5BE.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
19	PDB:6zheC	0.048	0.125	2.566E-1	705	0.009	0.026	6zheC.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
20	PDB:4kfzB	0.018	0.217	4.021E-1	148	0.005	0.074	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C9B9	1.72e-62	240	2256	0.051	0.046	DIDO1_MOUSE Death-inducer obliterator 1 OS=Mus musculus OX=10090 GN=Dido1 PE=1 SV=4
2	Q9BTC0	9.35e-62	237	2240	0.061	0.055	DIDO1_HUMAN Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5
3	B1ASB6	9.85e-59	224	1015	0.074	0.148	SPOC1_MOUSE SPOC domain-containing protein 1 OS=Mus musculus OX=10090 GN=Spocd1 PE=1 SV=3
4	Q9VG78	2.62e-26	121	2016	0.032	0.033	Q9VG78_DROME Protein partner of snf, isoform A OS=Drosophila melanogaster OX=7227 GN=pps PE=1 SV=1
5	A0A0B4K6G3	2.63e-26	121	2018	0.032	0.033	A0A0B4K6G3_DROME Protein partner of snf, isoform B OS=Drosophila melanogaster OX=7227 GN=pps PE=1 SV=1
6	Q9Y7V2	1.01e-24	114	721	0.076	0.215	BYE1_SCHPO Transcription factor bye1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bye1 PE=3 SV=3
7	A0A1W2PRL9	2.10e-11	69.3	280	0.022	0.157	A0A1W2PRL9_HUMAN Transcription elongation factor (Fragment) OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=1
8	A0A1W2PPZ5	3.42e-11	68.9	301	0.022	0.146	A0A1W2PPZ5_HUMAN Transcription elongation factor (Fragment) OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=1
9	A0A384MTX4	3.64e-11	68.9	301	0.022	0.146	A0A384MTX4_HUMAN Transcription elongation factor OS=Homo sapiens OX=9606 PE=2 SV=1
10	P23193	3.64e-11	68.9	301	0.022	0.146	TCEA1_HUMAN Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=2
11	Q4KLL0	6.03e-11	68.2	301	0.022	0.146	TCEA1_RAT Transcription elongation factor A protein 1 OS=Rattus norvegicus OX=10116 GN=Tcea1 PE=1 SV=1
12	P10711	6.14e-11	68.2	301	0.022	0.146	TCEA1_MOUSE Transcription elongation factor A protein 1 OS=Mus musculus OX=10090 GN=Tcea1 PE=1 SV=2
13	P23881	2.76e-10	66.6	347	0.021	0.121	TCEA3_MOUSE Transcription elongation factor A protein 3 OS=Mus musculus OX=10090 GN=Tcea3 PE=1 SV=3
14	Q15560	3.40e-09	62.8	299	0.019	0.127	TCEA2_HUMAN Transcription elongation factor A protein 2 OS=Homo sapiens OX=9606 GN=TCEA2 PE=1 SV=1
15	Q6IB64	3.40e-09	62.8	299	0.019	0.127	Q6IB64_HUMAN Transcription elongation factor OS=Homo sapiens OX=9606 GN=TCEA2 PE=2 SV=1
16	O75764	5.20e-09	62.8	348	0.020	0.118	TCEA3_HUMAN Transcription elongation factor A protein 3 OS=Homo sapiens OX=9606 GN=TCEA3 PE=1 SV=2
17	Q63799	9.22e-09	61.2	299	0.019	0.127	TCEA2_RAT Transcription elongation factor A protein 2 OS=Rattus norvegicus OX=10116 GN=Tcea2 PE=2 SV=1
18	Q3TMJ3	2.16e-08	62.0	669	0.013	0.040	Q3TMJ3_MOUSE Bptf protein (Fragment) OS=Mus musculus OX=10090 GN=Bptf PE=2 SV=1
19	A0A8I5ZVH2	2.72e-08	62.0	3043	0.014	0.009	A0A8I5ZVH2_RAT Bromodomain PHD finger transcription factor OS=Rattus norvegicus OX=10116 GN=Bptf PE=1 SV=1
20	Q6P9L3	2.73e-08	61.6	1114	0.013	0.024	Q6P9L3_MOUSE Bptf protein OS=Mus musculus OX=10090 GN=Bptf PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13232 Complex1_LYR_1	53	15.8	Complex1_LYR-like
2	PF00628 PHD	1.5e-05	36.1	PHD-finger
3	PF07744 SPOC	1.1e-26	105.1	SPOC domain
4	PF07500 TFIIS_M	4.9e-29	112.5	Transcription factor S-II (TFIIS), central domain
5	PF13832 zf-HC5HC2H_2	64	15.2	PHD-zinc-finger like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262043

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000282516	0.883	Nipped-B-like protein
2	9606.ENSP00000355205	0.767	DNA helicase INO80
3	9606.ENSP00000480158	0.753	DNA-directed RNA polymerase II subunit RPB1
4	9606.ENSP00000359685	0.721	Protein tyrosine phosphatase type IVA 1
5	9606.ENSP00000345808	0.715	Rho GTPase-activating protein 12
6	9606.ENSP00000386759	0.711	Histone-lysine N-methyltransferase SETD2
7	9606.ENSP00000417235	0.707	Mediator of RNA polymerase II transcription subunit 12-like protein
8	9606.ENSP00000349970	0.699	Endoplasmic reticulum-Golgi intermediate compartment protein 3
9	9606.ENSP00000307208	0.669	Nucleosome-remodeling factor subunit BPTF
10	9606.ENSP00000426632	0.657	Erbin
11	9606.ENSP00000346986	0.650	WW domain-containing adapter protein with coiled-coil
12	9606.ENSP00000259782	0.646	Tubulointerstitial nephritis antigen
13	9606.ENSP00000363809	0.643	Zinc transporter SLC39A7
14	9606.ENSP00000363817	0.643	Retinoic acid receptor RXR-beta
15	9606.ENSP00000359925	0.640	Leucine-rich repeat-containing protein 1
16	9606.ENSP00000381577	0.640	Ubiquitin carboxyl-terminal hydrolase 34
17	9606.ENSP00000457466	0.638	Chromodomain-helicase-DNA-binding protein 9
18	9606.ENSP00000220507	0.632	Rho-related GTP-binding protein RhoV
19	9606.ENSP00000359988	0.572	Serine/arginine-rich splicing factor 11
20	9606.ENSP00000483667	0.569	Chromodomain-helicase-DNA-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.966	heterocyclic compound binding
GO:0097159	0.966	organic cyclic compound binding
GO:0003676	0.944	nucleic acid binding
GO:0140110	0.381	transcription regulator activity
GO:0003723	0.324	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0019222	0.994	regulation of metabolic process
GO:0009987	0.989	cellular process
GO:0051171	0.977	regulation of nitrogen compound metabolic process
GO:0060255	0.972	regulation of macromolecule metabolic process
GO:0080090	0.969	regulation of primary metabolic process
GO:0031323	0.961	regulation of cellular metabolic process
GO:0044238	0.926	primary metabolic process
GO:0019219	0.909	regulation of nucleobase-containing compound metabolic process
GO:0006807	0.901	nitrogen compound metabolic process
GO:0071704	0.899	organic substance metabolic process
GO:0009889	0.886	regulation of biosynthetic process
GO:0048518	0.825	positive regulation of biological process
GO:1903506	0.822	regulation of nucleic acid-templated transcription
GO:0009893	0.821	positive regulation of metabolic process
GO:0048522	0.810	positive regulation of cellular process
GO:0006355	0.806	regulation of DNA-templated transcription
GO:0043170	0.763	macromolecule metabolic process
GO:0044237	0.652	cellular metabolic process
GO:1901360	0.520	organic cyclic compound metabolic process
GO:0010604	0.490	positive regulation of macromolecule metabolic process
GO:0034641	0.489	cellular nitrogen compound metabolic process
GO:0051173	0.486	positive regulation of nitrogen compound metabolic process
GO:0031325	0.439	positive regulation of cellular metabolic process
GO:0006139	0.419	nucleobase-containing compound metabolic process
GO:0048519	0.415	negative regulation of biological process
GO:0090304	0.413	nucleic acid metabolic process
GO:0045935	0.398	positive regulation of nucleobase-containing compound metabolic process
GO:0050896	0.372	response to stimulus
GO:0048523	0.363	negative regulation of cellular process
GO:0071840	0.362	cellular component organization or biogenesis
GO:0016043	0.322	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.522	cytoplasm
GO:0032991	0.420	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]