StarFunc result for job id Q92585

User Input

>input (1016 residues)
MVLPTCPMAEFALPRHSAVMERLRRRIELCRRHHSTCEARYEAVSPERLELERQHTFALH
QRCIQAKAKRAGKHRQPPAATAPAPAAPAPRLDAADGPEHGRPATHLHDTVKRNLDSATS
PQNGDQQNGYGDLFPGHKKTRREAPLGVAISSNGLPPASPLGQSDKPSGADALQSSGKHS
LGLDSLNKKRLADSSLHLNGGSNPSESFPLSLNKELKQEPVEDLPCMITGTVGSISQSNL
MPDLNLNEQEWKELIEELNRSVPDEDMKDLFNEDFEEKKDPESSGSATQTPLAQDINIKT
EFSPAAFEQEQLGSPQVRAGSAGQTFLGPSSAPVSTDSPSLGGSQTLFHTSGQPRADNPS
PNLMPASAQAQNAQRALAGVVLPSQGPGGASELSSAHQLQQIAAKQKREQMLQNPQQATP
APAPGQMSTWQQTGPSHSSLDVPYPMEKPASPSSYKQDFTNSKLLMMPSVNKSSPRPGGP
YLQPSHVNLLSHQPPSNLNQNSANNQGSVLDYGNTKPLSHYKADCGQGSPGSGQSKPALM
AYLPQQLSHISHEQNSLFLMKPKPGNMPFRSLVPPGQEQNPSSVPVQAQATSVGTQPPAV
SVASSHNSSPYLSSQQQAAVMKQHQLLLDQQKQREQQQKHLQQQQFLQRQQHLLAEQEKQ
QFQRHLTRPPPQYQDPTQGSFPQQVGQFTGSSAAVPGMNTLGPSNSSCPRVFPQAGNLMP
MGPGHASVSSLPTNSGQQDRGVAQFPGSQNMPQSSLYGMASGITQIVAQPPPQATNGHAH
IPRQTNVGQNTSVSAAYGQNSLGSSGLSQQHNKGTLNPGLTKPPVPRVSPAMGGQNSSWQ
HQGMPNLSGQTPGNSNVSPFTAASSFHMQQQAHLKMSSPQFSQAVPNRPMAPMSSAAAVG
SLLPPVSAQQRTSAPAPAPPPTAPQQGLPGLSPAGPELGAFSQSPASQMGGRAGLHCTQA
YPVRTAGQELPFAYSGQPGGSGLSSVAGHTDLIDSLLKNRTSEEWMSDLDDLLGSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6T264	0.154	0.154	0.000	1020	0.868	0.865	Q6T264.pdb.gz	MAML1_MOUSE Mastermind-like protein 1 OS=Mus musculus OX=10090 GN=Maml1 PE=1 SV=2
2	AFDB:Q92585	0.999	0.999	0.000	1016	1.000	1.000	Q92585.pdb.gz	MAML1_HUMAN Mastermind-like protein 1 OS=Homo sapiens OX=9606 GN=MAML1 PE=1 SV=3
3	AFDB:Q8IZL2	0.111	0.101	2.638E-17	1156	0.283	0.249	Q8IZL2.pdb.gz	MAML2_HUMAN Mastermind-like protein 2 OS=Homo sapiens OX=9606 GN=MAML2 PE=1 SV=2
4	AFDB:Q9N4G4	0.059	0.042	8.855E-4	1475	0.144	0.099	Q9N4G4.pdb.gz	MED1_CAEEL Mediator of RNA polymerase II transcription subunit 1.1 OS=Caenorhabditis elegans OX=6239 GN=sop-3 PE=1 SV=2
5	AFDB:A0A0R4IUG1	0.045	0.023	9.520E-4	2679	0.181	0.069	A0A0R4IUG1.pdb.gz
6	AFDB:Q02308	0.045	0.043	1.964E-3	1077	0.161	0.152	Q02308.pdb.gz	HLES_DROME Protein hairless OS=Drosophila melanogaster OX=7227 GN=H PE=1 SV=2
7	AFDB:Q69ZZ9	0.041	0.043	2.624E-3	979	0.154	0.159	Q69ZZ9.pdb.gz	K0754_MOUSE Microtubule-actin cross-linking factor 1, isoforms 6/7 OS=Mus musculus OX=10090 GN=Macf1 PE=2 SV=3
8	AFDB:Q24156	0.043	0.043	3.770E-3	1037	0.149	0.146	Q24156.pdb.gz	Q24156_DROME Transcription factor OS=Drosophila melanogaster OX=7227 GN=stwl PE=2 SV=1
9	AFDB:Q6PAC4	0.050	0.042	9.665E-3	1279	0.160	0.127	Q6PAC4.pdb.gz	PCARE_MOUSE Photoreceptor cilium actin regulator OS=Mus musculus OX=10090 GN=Pcare PE=2 SV=1
10	AFDB:B0G126	0.048	0.024	1.605E-2	2656	0.126	0.048	B0G126.pdb.gz	FYV1_DICDI 1-phosphatidylinositol 3-phosphate 5-kinase OS=Dictyostelium discoideum OX=44689 GN=pip5k3 PE=3 SV=1
11	PDB:4uhvB	0.032	0.048	7.581	645	0.026	0.040	4uhvB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6T264	0.0	1647	1020	0.860	0.857	MAML1_MOUSE Mastermind-like protein 1 OS=Mus musculus OX=10090 GN=Maml1 PE=1 SV=2
2	Q92585	0.0	2038	1016	1.000	1.000	MAML1_HUMAN Mastermind-like protein 1 OS=Homo sapiens OX=9606 GN=MAML1 PE=1 SV=3
3	Q96JK9	1.45e-67	249	1138	0.148	0.132	MAML3_HUMAN Mastermind-like protein 3 OS=Homo sapiens OX=9606 GN=MAML3 PE=1 SV=4
4	Q8IZL2	4.03e-09	63.2	1156	0.028	0.024	MAML2_HUMAN Mastermind-like protein 2 OS=Homo sapiens OX=9606 GN=MAML2 PE=1 SV=2
5	Q9Y3S1	0.46	37.0	2297	0.030	0.013	WNK2_HUMAN Serine/threonine-protein kinase WNK2 OS=Homo sapiens OX=9606 GN=WNK2 PE=1 SV=4
6	E9PCD1	0.48	37.0	2217	0.030	0.014	E9PCD1_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=WNK2 PE=1 SV=4
7	H0Y7T5	0.48	37.0	2220	0.030	0.014	H0Y7T5_HUMAN non-specific serine/threonine protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=WNK2 PE=1 SV=1
8	P21519	0.56	36.6	1594	0.027	0.017	MAM_DROME Neurogenic protein mastermind OS=Drosophila melanogaster OX=7227 GN=mam PE=2 SV=2
9	Q9FMF9	2.8	34.3	1269	0.017	0.013	Q9FMF9_ARATH Nuclear protein-like OS=Arabidopsis thaliana OX=3702 GN=MSJ1.11 PE=1 SV=1
10	Q6PDK2	7.6	33.1	5588	0.017	0.003	KMT2D_MOUSE Histone-lysine N-methyltransferase 2D OS=Mus musculus OX=10090 GN=Kmt2d PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09596 MamL-1	1.1e-22	91.4	MamL-1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000292599

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000277541	0.999	Neurogenic locus notch homolog protein 1
2	9606.ENSP00000345206	0.999	Recombining binding protein suppressor of hairless
3	9606.ENSP00000263253	0.997	Histone acetyltransferase p300
4	9606.ENSP00000256646	0.970	Neurogenic locus notch homolog protein 2
5	9606.ENSP00000338272	0.957	Hairy/enhancer-of-split related with YRPW motif protein 1
6	9606.ENSP00000364163	0.955	Neurogenic locus notch homolog protein 4
7	9606.ENSP00000367714	0.953	Transcription factor HES-5
8	9606.ENSP00000434552	0.950	Mastermind-like protein 2
9	9606.ENSP00000479618	0.947	Myc proto-oncogene protein
10	9606.ENSP00000357348	0.944	Hairy/enhancer-of-split related with YRPW motif protein 2
11	9606.ENSP00000361943	0.942	Hairy/enhancer-of-split related with YRPW motif-like protein
12	9606.ENSP00000263388	0.940	Neurogenic locus notch homolog protein 3
13	9606.ENSP00000268712	0.936	Nuclear receptor corepressor 1
14	9606.ENSP00000232424	0.933	Transcription factor HES-1
15	9606.ENSP00000477815	0.929	Pre T-cell antigen receptor alpha
16	9606.ENSP00000384018	0.926	Nuclear receptor corepressor 2
17	9606.ENSP00000370938	0.919	Cyclin-dependent kinase 8
18	9606.ENSP00000364912	0.918	Msx2-interacting protein
19	9606.ENSP00000362649	0.912	Histone deacetylase 1
20	9606.ENSP00000216341	0.904	Granzyme B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003713	1.000	transcription coactivator activity
GO:0019899	0.998	enzyme binding
GO:0042605	0.993	peptide antigen binding
GO:0019901	0.988	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0050896	0.990	response to stimulus
GO:0080090	0.989	regulation of primary metabolic process
GO:0051171	0.989	regulation of nitrogen compound metabolic process
GO:0048522	0.989	positive regulation of cellular process
GO:0031323	0.989	regulation of cellular metabolic process
GO:0010468	0.989	regulation of gene expression
GO:0009889	0.985	regulation of biosynthetic process
GO:0009893	0.977	positive regulation of metabolic process
GO:0006355	0.976	regulation of DNA-templated transcription
GO:0051716	0.970	cellular response to stimulus
GO:0010604	0.968	positive regulation of macromolecule metabolic process
GO:0051173	0.961	positive regulation of nitrogen compound metabolic process
GO:0023052	0.943	signaling
GO:0007154	0.943	cell communication
GO:0006357	0.939	regulation of transcription by RNA polymerase II
GO:0031325	0.928	positive regulation of cellular metabolic process
GO:0007165	0.926	signal transduction
GO:0045935	0.922	positive regulation of nucleobase-containing compound metabolic process
GO:0007219	0.915	Notch signaling pathway
GO:0045944	0.903	positive regulation of transcription by RNA polymerase II
GO:0045595	0.882	regulation of cell differentiation
GO:0019538	0.804	protein metabolic process
GO:0010830	0.797	regulation of myotube differentiation
GO:0045597	0.775	positive regulation of cell differentiation
GO:0051149	0.756	positive regulation of muscle cell differentiation
GO:0036211	0.718	protein modification process
GO:0051155	0.629	positive regulation of striated muscle cell differentiation
GO:0032502	0.518	developmental process
GO:0032501	0.502	multicellular organismal process
GO:0048856	0.501	anatomical structure development
GO:0007275	0.380	multicellular organism development
GO:0044237	0.372	cellular metabolic process
GO:0048523	0.333	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.988	protein-containing complex
GO:0005737	0.496	cytoplasm
GO:0002193	0.390	MAML1-RBP-Jkappa- ICN1 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]