StarFunc result for job id Q92600

User Input

>input (299 residues)
MHSLATAAPVPTTLAQVDREKIYQWINELSSPETRENALLELSKKRESVPDLAPMLWHSF
GTIAALLQEIVNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLY
PFLHTVSKTRPFEYLRLTSLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKT
VATFILQKILLDDTGLAYICQTYERFSHVAMILGKMVLQLSKEPSARLLKHVVRCYLRLS
DNPRAREALRQCLPDQLKDTTFAQVLKDDTTTKRWLAQLVKNLQEGQVTDPRGIPLPPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5PQL2	0.966	0.966	9.959E-37	299	0.997	0.997	Q5PQL2.pdb.gz	CNOT9_RAT CCR4-NOT transcription complex subunit 9 OS=Rattus norvegicus OX=10116 GN=Cnot9 PE=1 SV=1
2	PDB:4ct7B	0.896	0.995	5.895E-32	269	0.900	1.000	4ct7B.pdb.gz	Structural and Biochemical Insights to the Role of the Ccr4-not Complex and Ddx6 ATPase in Microrna Repression.
3	AFDB:Q7JVP2	0.927	0.912	1.720E-28	304	0.739	0.727	Q7JVP2.pdb.gz	Q7JVP2_DROME CCR4-NOT transcription complex subunit 9 OS=Drosophila melanogaster OX=7227 GN=Rcd-1 PE=1 SV=1
4	AFDB:Q8RWV5	0.915	0.867	2.016E-27	316	0.652	0.617	Q8RWV5.pdb.gz	Q8RWV5_ARATH Cell differentiation, Rcd1-like protein OS=Arabidopsis thaliana OX=3702 GN=NOT9A PE=1 SV=1
5	AFDB:Q9LXU1	0.905	0.871	8.532E-27	311	0.619	0.595	Q9LXU1.pdb.gz	Q9LXU1_ARATH Cell differentiation, Rcd1-like protein OS=Arabidopsis thaliana OX=3702 GN=NOT9B PE=1 SV=1
6	AFDB:Q92368	0.915	0.966	2.170E-26	283	0.635	0.671	Q92368.pdb.gz	RCD1_SCHPO Cell differentiation protein rcd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rcd1 PE=3 SV=1
7	AFDB:Q18224	0.882	0.800	4.658E-26	330	0.686	0.621	Q18224.pdb.gz	Q18224_CAEEL CCR4-NOT transcription complex subunit 9 OS=Caenorhabditis elegans OX=6239 GN=ntl-9 PE=1 SV=3
8	AFDB:Q9VLF2	0.912	0.940	1.716E-24	290	0.579	0.597	Q9VLF2.pdb.gz	Q9VLF2_DROME CCR4-NOT transcription complex subunit 9 OS=Drosophila melanogaster OX=7227 GN=Rcd-1r PE=2 SV=1
9	AFDB:P53829	0.889	0.715	1.697E-23	373	0.562	0.450	P53829.pdb.gz	CAF40_YEAST Protein CAF40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAF40 PE=1 SV=1
10	AFDB:Q57UT4	0.876	0.830	6.731E-21	316	0.472	0.446	Q57UT4.pdb.gz	Q57UT4_TRYB2 Cell differentiation protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.5D20.500 PE=3 SV=1
11	AFDB:Q553Y8	0.853	0.278	6.435E-17	941	0.411	0.131	Q553Y8.pdb.gz	Q553Y8_DICDI Cell differentiation family, Rcd1-like protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0275289 PE=3 SV=1
12	PDB:5tbkA	0.613	0.456	1.746E-3	417	0.161	0.115	5tbkA.pdb.gz
13	PDB:3zhpA	0.271	0.262	1.901E-3	315	0.124	0.117	3zhpA.pdb.gz
14	PDB:4tnmA	0.403	0.318	2.558E-3	407	0.134	0.098	4tnmA.pdb.gz
15	PDB:3gniA	0.292	0.270	3.747E-3	335	0.137	0.122	3gniA.pdb.gz	ATP and MO25alpha regulate the conformational state of the STRADalpha pseudokinase and activation of the LKB1 tumour suppressor
16	PDB:6kbnC	0.567	0.360	3.747E-3	504	0.137	0.081	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
17	PDB:6v8oN	0.379	0.314	4.441E-3	412	0.161	0.117	6v8oN.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
18	PDB:7rroH7	0.546	0.311	5.976E-3	580	0.124	0.064	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
19	PDB:2z6gA	0.449	0.275	6.235E-3	550	0.171	0.093	2z6gA.pdb.gz
20	PDB:7wug5	0.430	0.211	8.756E-3	782	0.171	0.065	7wug5.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5PQL2	0.0	612	299	0.997	0.997	CNOT9_RAT CCR4-NOT transcription complex subunit 9 OS=Rattus norvegicus OX=10116 GN=Cnot9 PE=1 SV=1
2	Q92600	0.0	613	299	1.000	1.000	CNOT9_HUMAN CCR4-NOT transcription complex subunit 9 OS=Homo sapiens OX=9606 GN=CNOT9 PE=1 SV=1
3	Q9JKY0	0.0	612	299	0.997	0.997	CNOT9_MOUSE CCR4-NOT transcription complex subunit 9 OS=Mus musculus OX=10090 GN=Cnot9 PE=1 SV=1
4	Q7JVP2	1.98e-162	456	304	0.739	0.727	Q7JVP2_DROME CCR4-NOT transcription complex subunit 9 OS=Drosophila melanogaster OX=7227 GN=Rcd-1 PE=1 SV=1
5	M9PF85	3.83e-158	444	301	0.726	0.721	M9PF85_DROME CCR4-NOT transcription complex subunit 9 OS=Drosophila melanogaster OX=7227 GN=Rcd-1 PE=1 SV=1
6	Q18224	3.02e-139	398	330	0.679	0.615	Q18224_CAEEL CCR4-NOT transcription complex subunit 9 OS=Caenorhabditis elegans OX=6239 GN=ntl-9 PE=1 SV=3
7	Q92368	1.67e-138	394	283	0.635	0.671	RCD1_SCHPO Cell differentiation protein rcd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rcd1 PE=3 SV=1
8	Q8RWV5	4.65e-135	387	316	0.652	0.617	Q8RWV5_ARATH Cell differentiation, Rcd1-like protein OS=Arabidopsis thaliana OX=3702 GN=NOT9A PE=1 SV=1
9	Q9LXU1	2.74e-129	372	311	0.605	0.582	Q9LXU1_ARATH Cell differentiation, Rcd1-like protein OS=Arabidopsis thaliana OX=3702 GN=NOT9B PE=1 SV=1
10	Q9VLF2	8.99e-117	339	290	0.579	0.597	Q9VLF2_DROME CCR4-NOT transcription complex subunit 9 OS=Drosophila melanogaster OX=7227 GN=Rcd-1r PE=2 SV=1
11	P53829	3.87e-114	335	373	0.555	0.445	CAF40_YEAST Protein CAF40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAF40 PE=1 SV=1
12	Q57UT4	3.67e-93	280	316	0.472	0.446	Q57UT4_TRYB2 Cell differentiation protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.5D20.500 PE=3 SV=1
13	Q553Y8	6.89e-70	234	941	0.408	0.130	Q553Y8_DICDI Cell differentiation family, Rcd1-like protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0275289 PE=3 SV=1
14	P30307	1.5	32.7	473	0.067	0.042	MPIP3_HUMAN M-phase inducer phosphatase 3 OS=Homo sapiens OX=9606 GN=CDC25C PE=1 SV=2
15	Q2TFN9	7.1	30.8	840	0.120	0.043	HSP74_CANLF Heat shock 70 kDa protein 4 OS=Canis lupus familiaris OX=9615 GN=HSPA4 PE=1 SV=1
16	Q9W129	7.4	30.4	296	0.057	0.057	Q9W129_DROME SCP domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG3640 PE=4 SV=1
17	Q53XS4	8.6	30.4	597	0.060	0.030	Q53XS4_HUMAN Tyrosine-protein phosphatase non-receptor type OS=Homo sapiens OX=9606 GN=PTPN6 PE=2 SV=1
18	P29351	8.8	30.4	595	0.060	0.030	PTN6_MOUSE Tyrosine-protein phosphatase non-receptor type 6 OS=Mus musculus OX=10090 GN=Ptpn6 PE=1 SV=2
19	P29350	8.9	30.4	595	0.060	0.030	PTN6_HUMAN Tyrosine-protein phosphatase non-receptor type 6 OS=Homo sapiens OX=9606 GN=PTPN6 PE=1 SV=1
20	Q9W437	9.3	30.4	1621	0.144	0.027	Q9W437_DROME Raptor, isoform B OS=Drosophila melanogaster OX=7227 GN=raptor PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04078 Rcd1	6.1e-130	443.7	Cell differentiation family, Rcd1-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000010675

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000004584	0.999	CCR4-NOT transcription complex, subunit 1
2	61853.ENSNLEP00000003079	0.998	CCR4-NOT transcription complex, subunit 7
3	61853.ENSNLEP00000007628	0.996	CCR4-NOT transcription complex, subunit 3
4	61853.ENSNLEP00000023527	0.996	CCR4-NOT transcription complex, subunit 2
5	61853.ENSNLEP00000016234	0.995	CCR4-NOT transcription complex, subunit 4
6	61853.ENSNLEP00000005353	0.993	CCR4-NOT transcription complex, subunit 10
7	61853.ENSNLEP00000002833	0.992	CCR4-NOT transcription complex, subunit 6
8	61853.ENSNLEP00000020166	0.990	CCR4-NOT transcription complex, subunit 8
9	61853.ENSNLEP00000009984	0.983	CCR4-NOT transcription complex, subunit 6-like
10	61853.ENSNLEP00000017609	0.983	CCR4-NOT transcription complex, subunit 11
11	61853.ENSNLEP00000009621	0.942	Transducer of ERBB2, 1
12	61853.ENSNLEP00000015311	0.913	Cytoplasmic polyadenylation element binding protein 3
13	61853.ENSNLEP00000015270	0.899	Tankyrase 1 binding protein 1, 182kDa
14	61853.ENSNLEP00000017651	0.884	Angel homolog 2 (Drosophila)
15	61853.ENSNLEP00000008861	0.846	Phosphodiesterase 12
16	61853.ENSNLEP00000002321	0.844	Leucine rich repeat containing 27
17	61853.ENSNLEP00000017017	0.844	Nocturnin
18	61853.ENSNLEP00000001766	0.808	Ski2 like RNA helicase 2
19	61853.ENSNLEP00000014436	0.806	Trinucleotide repeat containing 6A
20	61853.ENSNLEP00000003888	0.719	Polyadenylate-binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0080090	0.982	regulation of primary metabolic process
GO:0060255	0.979	regulation of macromolecule metabolic process
GO:0051171	0.979	regulation of nitrogen compound metabolic process
GO:0031323	0.979	regulation of cellular metabolic process
GO:0048519	0.962	negative regulation of biological process
GO:0048523	0.938	negative regulation of cellular process
GO:0051246	0.888	regulation of protein metabolic process
GO:0048518	0.881	positive regulation of biological process
GO:0048522	0.868	positive regulation of cellular process
GO:0050896	0.838	response to stimulus
GO:0051716	0.811	cellular response to stimulus
GO:0010468	0.796	regulation of gene expression
GO:0009889	0.795	regulation of biosynthetic process
GO:0010556	0.794	regulation of macromolecule biosynthetic process
GO:0031326	0.794	regulation of cellular biosynthetic process
GO:0009893	0.736	positive regulation of metabolic process
GO:0042221	0.729	response to chemical
GO:0010604	0.728	positive regulation of macromolecule metabolic process
GO:0023052	0.713	signaling
GO:0009892	0.703	negative regulation of metabolic process
GO:0031325	0.692	positive regulation of cellular metabolic process
GO:0031324	0.691	negative regulation of cellular metabolic process
GO:0051173	0.685	positive regulation of nitrogen compound metabolic process
GO:0034097	0.678	response to cytokine
GO:0010605	0.652	negative regulation of macromolecule metabolic process
GO:0051172	0.624	negative regulation of nitrogen compound metabolic process
GO:0019219	0.591	regulation of nucleobase-containing compound metabolic process
GO:0007154	0.565	cell communication
GO:0008152	0.562	metabolic process
GO:0070887	0.533	cellular response to chemical stimulus
GO:0071704	0.518	organic substance metabolic process
GO:0043170	0.470	macromolecule metabolic process
GO:0044238	0.466	primary metabolic process
GO:0044237	0.463	cellular metabolic process
GO:0006807	0.459	nitrogen compound metabolic process
GO:0007165	0.450	signal transduction
GO:0010608	0.446	post-transcriptional regulation of gene expression
GO:0009890	0.434	negative regulation of biosynthetic process
GO:0019221	0.423	cytokine-mediated signaling pathway
GO:0010558	0.385	negative regulation of macromolecule biosynthetic process
GO:0031327	0.367	negative regulation of cellular biosynthetic process
GO:0051252	0.347	regulation of RNA metabolic process
GO:0034641	0.324	cellular nitrogen compound metabolic process
GO:0051248	0.323	negative regulation of protein metabolic process
GO:0010629	0.310	negative regulation of gene expression
GO:0090304	0.310	nucleic acid metabolic process
GO:0006417	0.310	regulation of translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0032991	0.997	protein-containing complex
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0005829	0.989	cytosol
GO:0016020	0.974	membrane
GO:0140535	0.934	intracellular protein-containing complex
GO:0043227	0.915	membrane-bounded organelle
GO:0043231	0.902	intracellular membrane-bounded organelle
GO:0030014	0.892	CCR4-NOT complex
GO:0005634	0.822	nucleus
GO:0099080	0.788	supramolecular complex
GO:0070013	0.476	intracellular organelle lumen
GO:0031981	0.432	nuclear lumen
GO:0005654	0.338	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]