StarFunc result for job id Q92608

User Input

>input (1830 residues)
MAPWRKADKERHGVAIYNFQGSGAPQLSLQIGDVVRIQETCGDWYRGYLIKHKMLQGIFP
KSFIHIKEVTVEKRRNTENIIPAEIPLAQEVTTTLWEWGSIWKQLYVASKKERFLQVQSM
MYDLMEWRSQLLSGTLPKDELKELKQKVTSKIDYGNKILELDLIVRDEDGNILDPDNTSV
ISLFHAHEEATDKITERIKEEMSKDQPDYAMYSRISSSPTHSLYVFVRNFVCRIGEDAEL
FMSLYDPNKQTVISENYLVRWGSRGFPKEIEMLNNLKVVFTDLGNKDLNRDKIYLICQIV
RVGKMDLKDTGAKKCTQGLRRPFGVAVMDITDIIKGKAESDEEKQHFIPFHPVTAENDFL
HSLLGKVIASKGDSGGQGLWVTMKMLVGDIIQIRKDYPHLVDRTTVVARKLGFPEIIMPG
DVRNDIYITLLQGDFDKYNKTTQRNVEVIMCVCAEDGKTLPNAICVGAGDKPMNEYRSVV
YYQVKQPRWMETVKVAVPIEDMQRIHLRFMFRHRSSLESKDKGEKNFAMSYVKLMKEDGT
TLHDGFHDLVVLKGDSKKMEDASAYLTLPSYRHHVENKGATLSRSSSSVGGLSVSSRDVF
SISTLVCSTKLTQNVGLLGLLKWRMKPQLLQENLEKLKIVDGEEVVKFLQDTLDALFNIM
MEHSQSDEYDILVFDALIYIIGLIADRKFQHFNTVLEAYIQQHFSATLAYKKLMTVLKTY
LDTSSRGEQCEPILRTLKALEYVFKFIVRSRTLFSQLYEGKEQMEFEESMRRLFESINNL
MKSQYKTTILLQVAALKYIPSVLHDVEMVFDAKLLSQLLYEFYTCIPPVKLQKQKVQSMN
EIVQSNLFKKQECRDILLPVITKELKELLEQKDDMQHQVLERKYCVELLNSILEVLSYQD
AAFTYHHIQEIMVQLLRTVNRTVITMGRDHILISHFVACMTAILNQMGDQHYSFYIETFQ
TSSELVDFLMETFIMFKDLIGKNVYPGDWMAMSMVQNRVFLRAINKFAETMNQKFLEHTN
FEFQLWNNYFHLAVAFITQDSLQLEQFSHAKYNKILNKYGDMRRLIGFSIRDMWYKLGQN
KICFIPGMVGPILEMTLIPEAELRKATIPIFFDMMLCEYQRSGDFKKFENEIILKLDHEV
EGGRGDEQYMQLLESILMECAAEHPTIAKSVENFVNLVKGLLEKLLDYRGVMTDESKDNR
MSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQCAS
QVMQTGQQHPQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQ
NLIQQAKFYESIMKILRPKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLMT
QFPNAEKMNTTSAPGDDVKNAPGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQ
RFHYSRPVRRGTVDPENEFASMWIERTSFVTAYKLPGILRWFEVVHMSQTTISPLENAIE
TMSTANEKILMMINQYQSDETLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYVRDHP
EDQDKLTHLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVR
EMPDFDDRRVGRPRSMLRSYRQMSIISLASMNSDCSTPSKPTSESFDLELASPKTPRVEQ
EEPISPGSTLPEVKLRRSKKRTKRSSVVFADEKAAAESDLKRLSRKHEFMSDTNLSEHAA
IPLKASVLSQMSFASQSMPTIPALALSVAGIPGLDEANTSPRLSQTFLQLSDGDKKTLTR
KKVNQFFKTMLASKSAEEGKQIPDSLSTDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IUA6	0.693	0.690	0.000	1840	0.509	0.506	A0A0R4IUA6.pdb.gz
2	AFDB:B8JID6	0.827	0.811	0.000	1867	0.516	0.506	B8JID6.pdb.gz
3	AFDB:P59764	0.783	0.728	0.000	1978	0.360	0.333	P59764.pdb.gz	DOCK4_MOUSE Dedicator of cytokinesis protein 4 OS=Mus musculus OX=10090 GN=Dock4 PE=1 SV=1
4	AFDB:Q14185	0.878	0.862	0.000	1865	0.597	0.586	Q14185.pdb.gz	DOCK1_HUMAN Dedicator of cytokinesis protein 1 OS=Homo sapiens OX=9606 GN=DOCK1 PE=1 SV=2
5	AFDB:Q8IZD9	0.768	0.697	0.000	2030	0.366	0.330	Q8IZD9.pdb.gz	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1
6	AFDB:Q92608	1.000	1.000	0.000	1830	1.000	1.000	Q92608.pdb.gz	DOCK2_HUMAN Dedicator of cytokinesis protein 2 OS=Homo sapiens OX=9606 GN=DOCK2 PE=1 SV=2
7	AFDB:Q9H7D0	0.808	0.792	0.000	1870	0.554	0.542	Q9H7D0.pdb.gz	DOCK5_HUMAN Dedicator of cytokinesis protein 5 OS=Homo sapiens OX=9606 GN=DOCK5 PE=1 SV=3
8	PDB:6tgbA	0.677	0.842	2.159E-99	1450	0.564	0.712	6tgbA.pdb.gz
9	AFDB:Q06409	0.634	0.604	4.320E-53	1932	0.158	0.150	Q06409.pdb.gz	DCK1_YEAST DOCK-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCK1 PE=1 SV=1
10	AFDB:Q54DW1	0.229	0.240	9.920E-25	1736	0.093	0.099	Q54DW1.pdb.gz	Q54DW1_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=docC PE=3 SV=1
11	AFDB:Q9VEV4	0.104	0.154	8.872E-6	1067	0.074	0.127	Q9VEV4.pdb.gz	CL16A_DROME Protein CLEC16A homolog OS=Drosophila melanogaster OX=7227 GN=ema PE=1 SV=2
12	PDB:6pyuA	0.070	0.130	1.980E-5	930	0.046	0.090	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
13	PDB:4yknA	0.071	0.103	2.220E-5	1205	0.070	0.107	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
14	PDB:5dxhD	0.066	0.117	3.935E-5	981	0.054	0.100	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
15	PDB:6gy0A	0.066	0.136	5.986E-5	822	0.050	0.111	6gy0A.pdb.gz	A class of highly selective inhibitors bind to an active state of PI3K gamma.
16	PDB:7t3pA	0.098	0.091	8.766E-5	2066	0.098	0.087	7t3pA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
17	PDB:7t3qA	0.096	0.089	9.829E-5	2103	0.101	0.087	7t3qA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
18	PDB:3icqT	0.091	0.141	1.284E-4	949	0.065	0.125	3icqT.pdb.gz	Structures of the tRNA export factor in the nuclear and cytosolic states
19	PDB:7t3rA	0.093	0.085	1.284E-4	2130	0.102	0.087	7t3rA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
20	PDB:7mq8LM	0.149	0.141	1.334E-4	2005	0.050	0.045	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A096LNH6	2174	1886	0.584	0.567	A0A096LNH6_HUMAN Dedicator of cytokinesis 1 OS=Homo sapiens OX=9606 GN=DOCK1 PE=1 SV=1
2	A0A0B4K7Q6	1271	2008	0.387	0.353	A0A0B4K7Q6_DROME Myoblast city, isoform B OS=Drosophila melanogaster OX=7227 GN=mbc PE=3 SV=1
3	A0A0B4KHD2	1085	2008	0.344	0.314	A0A0B4KHD2_DROME Sponge, isoform F OS=Drosophila melanogaster OX=7227 GN=spg PE=1 SV=1
4	A8E1V6	2145	1866	0.571	0.560	A8E1V6_DANRE Dedicator of cytokinesis 1 OS=Danio rerio OX=7955 GN=dock1 PE=1 SV=1
5	A8E1V7	1825	1867	0.501	0.491	A8E1V7_DANRE Dedicator of cytokinesis 5 OS=Danio rerio OX=7955 GN=dock5 PE=1 SV=1
6	B2RY04	1967	1868	0.549	0.538	DOCK5_MOUSE Dedicator of cytokinesis protein 5 OS=Mus musculus OX=10090 GN=Dock5 PE=1 SV=2
7	B7Z0R2	1092	2002	0.345	0.316	B7Z0R2_DROME Sponge, isoform D OS=Drosophila melanogaster OX=7227 GN=spg PE=1 SV=2
8	G5EEN3	596	1781	0.256	0.263	G5EEN3_CAEEL CED-5 OS=Caenorhabditis elegans OX=6239 GN=ced-5 PE=1 SV=1
9	H0Y599	1153	1999	0.354	0.324	H0Y599_HUMAN Dedicator of cytokinesis 4 (Fragment) OS=Homo sapiens OX=9606 GN=DOCK4 PE=1 SV=1
10	H0Y7N4	1120	1090	0.320	0.538	H0Y7N4_HUMAN Dedicator of cytokinesis 5 (Fragment) OS=Homo sapiens OX=9606 GN=DOCK5 PE=1 SV=1
11	P59764	1162	1978	0.353	0.327	DOCK4_MOUSE Dedicator of cytokinesis protein 4 OS=Mus musculus OX=10090 GN=Dock4 PE=1 SV=1
12	Q14185	2188	1865	0.584	0.573	DOCK1_HUMAN Dedicator of cytokinesis protein 1 OS=Homo sapiens OX=9606 GN=DOCK1 PE=1 SV=2
13	Q149N5	1157	2011	0.355	0.323	Q149N5_HUMAN DOCK4 protein OS=Homo sapiens OX=9606 GN=DOCK4 PE=1 SV=1
14	Q8BUR4	2180	1865	0.580	0.569	DOCK1_MOUSE Dedicator of cytokinesis protein 1 OS=Mus musculus OX=10090 GN=Dock1 PE=1 SV=3
15	Q8C3J5	3594	1828	0.951	0.952	DOCK2_MOUSE Dedicator of cytokinesis protein 2 OS=Mus musculus OX=10090 GN=Dock2 PE=1 SV=3
16	Q8CIQ7	1167	2027	0.346	0.313	DOCK3_MOUSE Dedicator of cytokinesis protein 3 OS=Mus musculus OX=10090 GN=Dock3 PE=1 SV=1
17	Q8IZD9	1175	2030	0.349	0.315	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1
18	Q8MQW7	791	1292	0.232	0.329	Q8MQW7_DROME SD06708p (Fragment) OS=Drosophila melanogaster OX=7227 GN=mbc PE=2 SV=1
19	Q8MQY7	1153	1543	0.348	0.412	Q8MQY7_DROME RE54856p OS=Drosophila melanogaster OX=7227 GN=mbc PE=2 SV=1
20	Q8N1I0	1170	1966	0.352	0.328	DOCK4_HUMAN Dedicator of cytokinesis protein 4 OS=Homo sapiens OX=9606 GN=DOCK4 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06920 DHR-2_Lobe_A	9.1e-13	60.3	DHR-2, Lobe A
2	PF20422 DHR-2_Lobe_B	1.1e-09	49.5	DHR-2, Lobe B
3	PF20421 DHR-2_Lobe_C	5.3e-16	69.8	DHR-2, Lobe C
4	PF14429 DOCK-C2	3.9e-58	207.9	C2 domain in Dock180 and Zizimin proteins
5	PF16172 DOCK_N	9.6e-104	359.0	DOCK N-terminus
6	PF07560 DUF1539	1.2e+02	14.2	Domain of Unknown Function (DUF1539)
7	PF00018 SH3_1	1.6	19.7	SH3 domain
8	PF07653 SH3_2	0.16	23.1	Variant SH3 domain
9	PF14604 SH3_9	30	16.0	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256935

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312185	0.999	Engulfment and cell motility protein 1
2	9606.ENSP00000249071	0.992	Ras-related C3 botulinum toxin substrate 2
3	9606.ENSP00000348461	0.988	Ras-related C3 botulinum toxin substrate 1
4	9606.ENSP00000304283	0.979	Ras-related C3 botulinum toxin substrate 3
5	9606.ENSP00000346300	0.973	Crk-like protein
6	9606.ENSP00000363117	0.940	Tyrosine-protein kinase Fgr
7	9606.ENSP00000444986	0.938	Tyrosine-protein kinase HCK
8	9606.ENSP00000300574	0.924	Adapter molecule crk
9	9606.ENSP00000428924	0.921	Tyrosine-protein kinase Lyn
10	9606.ENSP00000451828	0.920	RAC-alpha serine/threonine-protein kinase
11	9606.ENSP00000312999	0.913	Guanine nucleotide-binding protein G(i) subunit alpha-2
12	9606.ENSP00000323047	0.900	Mitochondrial ribosome-associated GTPase 1
13	9606.ENSP00000290246	0.872	Engulfment and cell motility protein 2
14	9606.ENSP00000362680	0.866	Proto-oncogene tyrosine-protein kinase Src
15	9606.ENSP00000383118	0.858	Cell division control protein 42 homolog
16	9606.ENSP00000472929	0.855	Proto-oncogene vav
17	9606.ENSP00000380948	0.788	Integrin beta-2
18	9606.ENSP00000046794	0.786	Lymphocyte cytosolic protein 2
19	9606.ENSP00000411355	0.786	Receptor-type tyrosine-protein phosphatase C
20	9606.ENSP00000377566	0.757	Engulfment and cell motility protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0005102	0.602	signaling receptor binding
GO:0044877	0.522	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0048583	0.988	regulation of response to stimulus
GO:0023051	0.967	regulation of signaling
GO:0051716	0.964	cellular response to stimulus
GO:0048518	0.964	positive regulation of biological process
GO:0009966	0.962	regulation of signal transduction
GO:0032501	0.960	multicellular organismal process
GO:0048856	0.958	anatomical structure development
GO:0007154	0.956	cell communication
GO:0051056	0.938	regulation of small GTPase mediated signal transduction
GO:0071840	0.934	cellular component organization or biogenesis
GO:0016043	0.920	cellular component organization
GO:0023052	0.875	signaling
GO:0006996	0.831	organelle organization
GO:0007165	0.831	signal transduction
GO:0030097	0.828	hemopoiesis
GO:0048522	0.787	positive regulation of cellular process
GO:0007010	0.753	cytoskeleton organization
GO:0001775	0.723	cell activation
GO:0002376	0.686	immune system process
GO:0051179	0.645	localization
GO:0030029	0.548	actin filament-based process
GO:0051234	0.522	establishment of localization
GO:0006810	0.482	transport
GO:0042221	0.464	response to chemical
GO:0048584	0.423	positive regulation of response to stimulus
GO:0016192	0.398	vesicle-mediated transport
GO:0048519	0.389	negative regulation of biological process
GO:0051239	0.317	regulation of multicellular organismal process
GO:0030155	0.311	regulation of cell adhesion
GO:0030036	0.302	actin cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0031974	0.988	membrane-enclosed lumen
GO:0070013	0.978	intracellular organelle lumen
GO:0005886	0.975	plasma membrane
GO:0043231	0.957	intracellular membrane-bounded organelle
GO:0012505	0.617	endomembrane system
GO:0031982	0.483	vesicle
GO:0005634	0.394	nucleus
GO:0043230	0.379	extracellular organelle
GO:0031410	0.372	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]