StarFunc result for job id Q92610

User Input

>input (1267 residues)
MGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQTPSEENESPLKPPGICMDESVSLSHSGSA
PDVPAVSVIVKNTSRQESFEAEKDHITPSLLHNGFRGSDLPPDPHNCGKFDSTFMNGDSA
RSFPGKLEPPKSEPLPTFNQFSPISSPEPEDPIKDNGFGIKPKHSDSYFPPPLGCGAVGG
PVLEALAKFPVPELHMFDHFCKKEPKPEPLPLGSQQEHEQSGQNTVEPHKDPDATRFFGE
ALEFNSHPSNSIGESKGLARELGTCSSVPPRQRLKPAHSKLSSCVAALVALQAKRVASVT
KEDQPGHTKDLSGPTKESSKGSPKMPKSPKSPRSPLEATRKSIKPSDSPRSICSDSSSKG
SPSVAASSPPAIPKVRIKTIKTSSGEIKRTVTRILPDPDDPSKSPVGSPLGSAIAEAPSE
MPGDEVPVEEHFPEAGTNSGSPQGARKGDESMTKASDSSSPSCSSGPRVPKGAAPGSQTG
KKQQSTALQASTLAPANLLPKAVHLANLNLVPHSVAASVTAKSSVQRRSQPQLTQMSVPL
VHQVKKAAPLIVEVFNKVLHSSNPVPLYAPNLSPPADSRIHVPASGYCCLECGDAFALEK
SLSQHYGRRSVHIEVLCTLCSKTLLFFNKCSLLRHARDHKSKGLVMQCSQLLVKPISADQ
MFVSAPVNSTAPAAPAPSSSPKHGLTSGSASPPPPALPLYPDPVRLIRYSIKCLECHKQM
RDYMVLAAHFQRTTEETEGLTCQVCQMLLPNQCSFCAHQRIHAHKSPYCCPECGVLCRSA
YFQTHVKENCLHYARKVGYRCIHCGVVHLTLALLKSHIQERHCQVFHKCAFCPMAFKTAS
STADHSATQHPTQPHRPSQLIYKCSCEMVFNKKRHIQQHFYQNVSKTQVGVFKCPECPLL
FVQKPELMQHVKSTHGVPRNVDELSSLQSSADTSSSRPGSRVPTEPPATSVAARSSSLPS
GRWGRPEAHRRVEARPRLRNTGWTCQECQEWVPDRESYVSHMKKSHGRTLKRYPCRQCEQ
SFHTPNSLRKHIRNNHDTVKKFYTCGYCTEDSPSFPRPSLLESHISLMHGIRNPDLSQTS
KVKPPGGHSPQVNHLKRPVSGVGDAPGTSNGATVSSTKRHKSLFQCAKCSFATDSGLEFQ
SHIPQHQVDSSTAQCLLCGLCYTSASSLSRHLFIVHKVRDQEEEEEEEAAAAEMAVEVAE
PEEGSGEEVPMETRENGLEECAGEPLSADPEARRLLGPAPEDDGGHNDHSQPQASQDQDS
HTLSPQV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BHZ4	0.411	0.413	0.000	1262	0.875	0.878	Q8BHZ4.pdb.gz	ZN592_MOUSE Zinc finger protein 592 OS=Mus musculus OX=10090 GN=Znf592 PE=1 SV=3
2	AFDB:Q92610	0.999	0.999	0.000	1267	1.000	1.000	Q92610.pdb.gz	ZN592_HUMAN Zinc finger protein 592 OS=Homo sapiens OX=9606 GN=ZNF592 PE=1 SV=2
3	AFDB:Q8N1G0	0.252	0.257	9.151E-75	1237	0.320	0.327	Q8N1G0.pdb.gz	ZN687_HUMAN Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1
4	AFDB:Q0E8J0	0.052	0.056	5.847E-10	1152	0.144	0.159	Q0E8J0.pdb.gz	Q0E8J0_DROME MEP-1, isoform A OS=Drosophila melanogaster OX=7227 GN=MEP-1 PE=1 SV=1
5	AFDB:P47043	0.052	0.065	5.024E-7	880	0.113	0.163	P47043.pdb.gz	ZAP1_YEAST Zinc-responsive transcriptional regulator ZAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ZAP1 PE=1 SV=1
6	AFDB:E1JJ76	0.040	0.042	1.199E-5	1165	0.126	0.137	E1JJ76.pdb.gz	E1JJ76_DROME Alhambra, isoform H OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
7	AFDB:A0A0B4KFQ4	0.036	0.040	3.882E-5	1133	0.134	0.150	A0A0B4KFQ4.pdb.gz	A0A0B4KFQ4_DROME Alhambra, isoform O OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
8	AFDB:A2A935	0.041	0.041	2.861E-4	1275	0.119	0.118	A2A935.pdb.gz	PRD16_MOUSE Histone-lysine N-methyltransferase PRDM16 OS=Mus musculus OX=10090 GN=Prdm16 PE=1 SV=1
9	AFDB:Q8IQT4	0.032	0.023	3.034E-4	2133	0.154	0.091	Q8IQT4.pdb.gz	Q8IQT4_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Nirvana PE=1 SV=1
10	AFDB:Q9VFH4	0.035	0.037	4.855E-4	1200	0.135	0.142	Q9VFH4.pdb.gz	Q9VFH4_DROME LD12755p OS=Drosophila melanogaster OX=7227 GN=l(3)L1231 PE=2 SV=1
11	PDB:3w5kB	0.030	0.236	4.144E-2	110	0.020	0.227	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4exmA	0.032	0.110	1.582	291	0.011	0.048	4exmA.pdb.gz
13	PDB:5apny	0.029	0.114	2.123	211	0.020	0.118	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
14	PDB:7o4iW	0.028	0.084	2.532	312	0.032	0.128	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
15	PDB:4r8pL	0.025	0.083	3.601	254	0.005	0.024	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
16	PDB:7uhyD	0.027	0.083	3.819	288	0.015	0.066	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
17	PDB:2le2A	0.029	0.265	4.296	56	0.006	0.125	2le2A.pdb.gz
18	PDB:4ijzB	0.026	0.085	4.831	275	0.007	0.033	4ijzB.pdb.gz
19	PDB:7ao8C	0.019	0.347	4.831	64	0.003	0.062	7ao8C.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
20	PDB:6hivCa	0.029	0.054	5.123	592	0.014	0.030	6hivCa.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BHZ4	0.0	2198	1262	0.876	0.880	ZN592_MOUSE Zinc finger protein 592 OS=Mus musculus OX=10090 GN=Znf592 PE=1 SV=3
2	Q92610	0.0	2588	1267	1.000	1.000	ZN592_HUMAN Zinc finger protein 592 OS=Homo sapiens OX=9606 GN=ZNF592 PE=1 SV=2
3	Q9HCE3	0.0	687	1301	0.318	0.310	ZN532_HUMAN Zinc finger protein 532 OS=Homo sapiens OX=9606 GN=ZNF532 PE=1 SV=2
4	Q8N1G0	1.25e-115	392	1237	0.191	0.196	ZN687_HUMAN Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1
5	Q9P2J8	1.13e-14	81.6	865	0.141	0.207	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
6	Q8N7K0	2.85e-14	80.1	673	0.103	0.193	ZN433_HUMAN Zinc finger protein 433 OS=Homo sapiens OX=9606 GN=ZNF433 PE=1 SV=1
7	Q76KX8	3.90e-13	76.3	674	0.107	0.202	ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens OX=9606 GN=ZNF534 PE=1 SV=1
8	Q15937	7.07e-13	75.1	498	0.067	0.171	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
9	Q9UEG4	1.28e-12	75.1	869	0.063	0.092	ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens OX=9606 GN=ZNF629 PE=1 SV=2
10	P51814	3.47e-12	73.6	821	0.092	0.141	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
11	Q8NEP9	4.75e-12	72.8	628	0.085	0.172	ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens OX=9606 GN=ZNF555 PE=1 SV=4
12	Q60821	8.47e-12	72.4	794	0.074	0.118	ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus OX=10090 GN=Zbtb17 PE=1 SV=2
13	Q13105	1.77e-11	71.2	803	0.072	0.113	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3
14	Q8IZ26	3.06e-11	70.1	560	0.068	0.154	ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=3
15	A0A0C4DG42	3.09e-11	70.1	539	0.068	0.160	A0A0C4DG42_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=1
16	Q96NL3	6.68e-11	68.9	588	0.084	0.180	ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens OX=9606 GN=ZNF599 PE=1 SV=1
17	P17040	1.03e-10	68.9	1043	0.065	0.079	ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens OX=9606 GN=ZSCAN20 PE=1 SV=3
18	O96395	1.19e-10	68.2	583	0.067	0.146	O96395_DROME LD05664p OS=Drosophila melanogaster OX=7227 GN=Meics PE=2 SV=2
19	Q9Y473	1.20e-10	68.6	711	0.069	0.124	ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens OX=9606 GN=ZNF175 PE=1 SV=1
20	O61360	1.34e-10	68.6	962	0.082	0.108	O61360_DROME CROL ALPHA OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	0.0083	27.7	Zinc finger, C2H2 type
2	PF16622 zf-C2H2_11	1.8e-12	58.1	zinc-finger C2H2-type
3	PF13894 zf-C2H2_4	0.0024	29.6	C2H2-type zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000452877

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000420095	0.940	Protein kinase C-binding protein 1
2	9606.ENSP00000364550	0.810	Lysine-specific demethylase 5C
3	9606.ENSP00000432568	0.778	Spectrin beta chain, non-erythrocytic 2
4	9606.ENSP00000319829	0.752	Zinc finger protein 687
5	9606.ENSP00000302728	0.662	Beta-glucuronidase
6	9606.ENSP00000292246	0.631	Anoctamin-10
7	9606.ENSP00000442793	0.619	Protein BEAN1
8	9606.ENSP00000355986	0.597	Synaptotagmin-14
9	9606.ENSP00000337353	0.595	Tyrosyl-DNA phosphodiesterase 1
10	9606.ENSP00000355741	0.570	Atypical kinase COQ8A, mitochondrial
11	9606.ENSP00000258888	0.559	Alpha-protein kinase 3
12	9606.ENSP00000387982	0.552	WD repeat-containing protein 73
13	9606.ENSP00000471730	0.546	Protein PPP5D1
14	9606.ENSP00000414055	0.535	Nuclear receptor-binding protein 2
15	9606.ENSP00000362649	0.532	Histone deacetylase 1
16	9606.ENSP00000252934	0.528	Ataxin-10
17	9606.ENSP00000349508	0.521	Chromodomain-helicase-DNA-binding protein 4
18	9606.ENSP00000407509	0.514	Neuropathy target esterase
19	9606.ENSP00000353463	0.500	Transcriptional repressor p66-alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.386	heterocyclic compound binding
GO:0097159	0.386	organic cyclic compound binding
GO:0003676	0.377	nucleic acid binding
GO:0003677	0.335	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.987	regulation of cellular process
GO:0019222	0.961	regulation of metabolic process
GO:0060255	0.953	regulation of macromolecule metabolic process
GO:0051171	0.931	regulation of nitrogen compound metabolic process
GO:0080090	0.924	regulation of primary metabolic process
GO:0031323	0.918	regulation of cellular metabolic process
GO:0048523	0.916	negative regulation of cellular process
GO:1900076	0.775	regulation of cellular response to insulin stimulus
GO:0046626	0.775	regulation of insulin receptor signaling pathway
GO:0048585	0.740	negative regulation of response to stimulus
GO:0009987	0.653	cellular process
GO:0010648	0.610	negative regulation of cell communication
GO:0009968	0.603	negative regulation of signal transduction
GO:0046627	0.591	negative regulation of insulin receptor signaling pathway
GO:0051246	0.524	regulation of protein metabolic process
GO:0010468	0.425	regulation of gene expression
GO:0019219	0.322	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.304	regulation of cellular biosynthetic process
GO:0050730	0.300	regulation of peptidyl-tyrosine phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.989	cytoplasm
GO:0070013	0.868	intracellular organelle lumen
GO:0005654	0.857	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]