StarFunc result for job id Q92611

User Input

>input (657 residues)
MQWRALVLGLVLLRLGLHGVLWLVFGLGPSMGFYQRFPLSFGFQRLRSPDGPASPTSGPV
GRPGGVSGPSWLQPPGTGAAQSPRKAPRRPGPGMCGPANWGYVLGGRGRGPDEYEKRYSG
AFPPQLRAQMRDLARGMFVFGYDNYMAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLG
NYSLTLVDALDTLAIMGNSSEFQKAVKLVINTVSFDKDSTVQVFEATIRVLGSLLSAHRI
ITDSKQPFGDMTIKDYDNELLYMAHDLAVRLLPAFENTKTGIPYPRVNLKTGVPPDTNNE
TCTAGAGSLLVEFGILSRLLGDSTFEWVARRAVKALWNLRSNDTGLLGNVVNIQTGHWVG
KQSGLGAGLDSFYEYLLKSYILFGEKEDLEMFNAAYQSIQNYLRRGREACNEGEGDPPLY
VNVNMFSGQLMNTWIDSLQAFFPGLQVLIGDVEDAICLHAFYYAIWKRYGALPERYNWQL
QAPDVLFYPLRPELVESTYLLYQATKNPFYLHVGMDILQSLEKYTKVKCGYATLHHVIDK
STEDRMESFFLSETCKYLYLLFDEDNPVHKSGTRYMFTTEGHIVSVDEHLRELPWKEFFS
EEGGQDQGGKSVHRPKPHELKVINSSSNCNRVPDERRYSLPLKSIYMRQIDQMVGLI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R2D5	0.869	0.869	9.798E-103	657	1.000	1.000	A0A024R2D5.pdb.gz
2	AFDB:Q5ZK76	0.816	0.870	4.905E-87	616	0.790	0.843	Q5ZK76.pdb.gz	Q5ZK76_CHICK alpha-1,2-Mannosidase OS=Gallus gallus OX=9031 GN=EDEM1 PE=2 SV=1
3	AFDB:O94726	0.706	0.590	9.786E-51	787	0.341	0.285	O94726.pdb.gz	MNL1_SCHPO ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2
4	AFDB:Q9FG93	0.656	0.690	2.142E-46	624	0.339	0.357	Q9FG93.pdb.gz	MNS4_ARATH Alpha-mannosidase I MNS4 OS=Arabidopsis thaliana OX=3702 GN=MNS4 PE=1 SV=1
5	AFDB:Q9SXC9	0.659	0.753	6.088E-45	574	0.335	0.383	Q9SXC9.pdb.gz	MNS5_ARATH Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1
6	AFDB:Q8MS36	0.670	0.552	5.761E-44	801	0.324	0.266	Q8MS36.pdb.gz	Q8MS36_DROME alpha-1,2-Mannosidase OS=Drosophila melanogaster OX=7227 GN=Edem2 PE=2 SV=1
7	AFDB:Q9BZQ6	0.695	0.496	4.293E-43	932	0.335	0.236	Q9BZQ6.pdb.gz	EDEM3_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Homo sapiens OX=9606 GN=EDEM3 PE=1 SV=2
8	AFDB:P38888	0.673	0.557	5.677E-42	796	0.309	0.255	P38888.pdb.gz	MNL1_YEAST ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNL1 PE=1 SV=1
9	AFDB:Q9BV94	0.657	0.745	6.504E-41	578	0.320	0.363	Q9BV94.pdb.gz	EDEM2_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Homo sapiens OX=9606 GN=EDEM2 PE=1 SV=2
10	AFDB:M9PG98	0.651	0.430	2.255E-40	1004	0.326	0.213	M9PG98.pdb.gz	M9PG98_DROME alpha-1,2-Mannosidase OS=Drosophila melanogaster OX=7227 GN=Edem1 PE=1 SV=1
11	PDB:1dl2A	0.606	0.771	3.920E-25	510	0.224	0.288	1dl2A.pdb.gz
12	PDB:1fp3A	0.382	0.587	5.240E-6	402	0.072	0.117	1fp3A.pdb.gz
13	PDB:2rgkA	0.345	0.504	9.757E-6	409	0.070	0.112	2rgkA.pdb.gz
14	PDB:3qxqA	0.305	0.531	2.644E-4	338	0.065	0.127	3qxqA.pdb.gz	Apo- and cellopentaose-bound structures of the bacterial cellulose synthase subunit BcsZ.
15	PDB:3t33A	0.361	0.530	1.551E-3	407	0.091	0.147	3t33A.pdb.gz	Crystal Structure of Arabidopsis GCR2 Identifies a Novel Clade of Lantibiotic Cyclase-Like Proteins
16	PDB:1ut9A	0.249	0.264	2.753E-3	605	0.085	0.093	1ut9A.pdb.gz
17	PDB:5hssA	0.250	0.410	5.125E-3	366	0.043	0.077	5hssA.pdb.gz	X-ray structure of linalool dehydratase/isomerase from Castellaniella defragrans reveals enzymatic alkene synthesis.
18	PDB:3vxdC	0.253	0.393	1.399E-2	359	0.094	0.173	3vxdC.pdb.gz
19	PDB:3aniA	0.285	0.431	2.051E-2	378	0.087	0.151	3aniA.pdb.gz
20	PDB:6trhC	0.276	0.414	5.088E-2	385	0.079	0.135	6trhC.pdb.gz	Structural analysis of the reducing-end xylose-releasing exo-oligoxylanase Rex8A from Paenibacillus barcinonensis BP-23 deciphers its molecular specificity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5ZK76	0.0	996	616	0.750	0.800	Q5ZK76_CHICK alpha-1,2-Mannosidase OS=Gallus gallus OX=9031 GN=EDEM1 PE=2 SV=1
2	Q925U4	0.0	1169	652	0.916	0.923	EDEM1_MOUSE ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1
3	Q92611	0.0	1361	657	1.000	1.000	EDEM1_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens OX=9606 GN=EDEM1 PE=1 SV=1
4	O94726	1.71e-137	423	787	0.333	0.278	MNL1_SCHPO ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2
5	Q9SXC9	1.15e-133	406	574	0.352	0.402	MNS5_ARATH Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1
6	Q9FG93	7.99e-130	398	624	0.339	0.357	MNS4_ARATH Alpha-mannosidase I MNS4 OS=Arabidopsis thaliana OX=3702 GN=MNS4 PE=1 SV=1
7	Q8MS36	3.64e-123	386	801	0.321	0.263	Q8MS36_DROME alpha-1,2-Mannosidase OS=Drosophila melanogaster OX=7227 GN=Edem2 PE=2 SV=1
8	M9PCV1	4.73e-123	385	792	0.321	0.266	M9PCV1_DROME alpha-1,2-Mannosidase OS=Drosophila melanogaster OX=7227 GN=Edem2 PE=1 SV=1
9	Q9VK27	6.47e-123	385	801	0.321	0.263	Q9VK27_DROME alpha-1,2-Mannosidase OS=Drosophila melanogaster OX=7227 GN=Edem2 PE=1 SV=2
10	Q2HXL6	1.85e-121	385	931	0.320	0.226	EDEM3_MOUSE ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Mus musculus OX=10090 GN=Edem3 PE=1 SV=2
11	Q9BZQ6	1.02e-120	383	932	0.320	0.225	EDEM3_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Homo sapiens OX=9606 GN=EDEM3 PE=1 SV=2
12	Q9BV94	6.80e-115	358	578	0.326	0.370	EDEM2_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Homo sapiens OX=9606 GN=EDEM2 PE=1 SV=2
13	Q7JUF8	5.54e-114	367	982	0.323	0.216	Q7JUF8_DROME alpha-1,2-Mannosidase OS=Drosophila melanogaster OX=7227 GN=Edem1 PE=1 SV=1
14	O46091	6.14e-114	367	995	0.323	0.213	O46091_DROME alpha-1,2-Mannosidase OS=Drosophila melanogaster OX=7227 GN=Edem1 PE=3 SV=1
15	M9PG98	7.72e-114	367	1004	0.323	0.211	M9PG98_DROME alpha-1,2-Mannosidase OS=Drosophila melanogaster OX=7227 GN=Edem1 PE=1 SV=1
16	Q8BJT9	8.69e-114	355	577	0.327	0.373	EDEM2_MOUSE ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Mus musculus OX=10090 GN=Edem2 PE=1 SV=1
17	P38888	2.04e-110	352	796	0.306	0.253	MNL1_YEAST ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNL1 PE=1 SV=1
18	Q57W82	1.16e-86	284	588	0.257	0.287	Q57W82_TRYB2 alpha-1,2-Mannosidase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28F14.300 PE=3 SV=1
19	Q57W81	2.73e-79	265	597	0.271	0.298	Q57W81_TRYB2 alpha-1,2-Mannosidase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28F14.310 PE=3 SV=1
20	Q57W80	1.21e-76	258	597	0.259	0.285	Q57W80_TRYB2 alpha-1,2-Mannosidase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28F14.320 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01532 Glyco_hydro_47	8.2e-119	409.1	Glycosyl hydrolase family 47

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256497

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337053	0.997	Protein sel-1 homolog 1
2	9606.ENSP00000264065	0.993	DnaJ homolog subfamily C member 10
3	9606.ENSP00000247461	0.985	Calnexin
4	9606.ENSP00000216037	0.983	X-box-binding protein 1
5	9606.ENSP00000158771	0.975	Derlin-2
6	9606.ENSP00000318165	0.944	Protein OS-9
7	9606.ENSP00000416066	0.877	Alpha-1-antitrypsin
8	9606.ENSP00000324173	0.875	78 kDa glucose-regulated protein
9	9606.ENSP00000185150	0.873	Endoplasmic reticulum lectin 1
10	9606.ENSP00000384744	0.862	Derlin-3
11	9606.ENSP00000327801	0.851	Protein disulfide-isomerase
12	9606.ENSP00000366395	0.844	E3 ubiquitin-protein ligase synoviolin
13	9606.ENSP00000318147	0.829	ER degradation-enhancing alpha-mannosidase-like protein 3
14	9606.ENSP00000300289	0.828	Protein disulfide-isomerase A3
15	9606.ENSP00000286091	0.826	Protein disulfide-isomerase A4
16	9606.ENSP00000363616	0.822	ER degradation-enhancing alpha-mannosidase-like protein 2
17	9606.ENSP00000473631	0.802	DnaJ homolog subfamily C member 3
18	9606.ENSP00000401445	0.800	Serine/threonine-protein kinase/endoribonuclease IRE1
19	9606.ENSP00000249356	0.797	DnaJ homolog subfamily B member 9
20	9606.ENSP00000320866	0.783	Calreticulin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004571	1.000	mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
GO:0005515	0.997	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0006517	0.997	protein deglycosylation
GO:0051716	0.995	cellular response to stimulus
GO:0033554	0.990	cellular response to stress
GO:0032386	0.988	regulation of intracellular transport
GO:0010243	0.985	response to organonitrogen compound
GO:0006511	0.985	ubiquitin-dependent protein catabolic process
GO:0030433	0.983	ubiquitin-dependent ERAD pathway
GO:0033157	0.982	regulation of intracellular protein transport
GO:0032388	0.975	positive regulation of intracellular transport
GO:0090316	0.965	positive regulation of intracellular protein transport
GO:1901700	0.665	response to oxygen-containing compound
GO:0051179	0.521	localization
GO:0051234	0.508	establishment of localization
GO:0051641	0.500	cellular localization
GO:0006810	0.500	transport
GO:0033036	0.326	macromolecule localization
GO:0008104	0.317	protein localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0016020	0.996	membrane
GO:0031090	0.960	organelle membrane
GO:0031984	0.956	organelle subcompartment
GO:0005789	0.901	endoplasmic reticulum membrane
GO:0016234	0.363	inclusion body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.113	1.000	mannosyl-oligosaccharide 1,2-alpha-mannosidase.

[back to server]