StarFunc result for job id Q92613

User Input

>input (823 residues)
MKRHRPVSSSDSSDESPSTSFTSGSMYRIKSKIPNEHKKPAEVFRKDLISAMKLPDSHHI
NPDSYYLFADTWKEEWEKGVQVPASPDTVPQPSLRIIAEKVKDVLFIRPRKYIHCSSPDT
TEPGYINIMELAASVCRYDLDDMDIFWLQELNEDLAEMGCGPVDENLMEKTVEVLERHCH
ENMNHAIETEEGLGIEYDEDVICDVCRSPDSEEGNDMVFCDKCNVCVHQACYGILKVPEG
SWLCRSCVLGIYPQCVLCPKKGGALKTTKTGTKWAHVSCALWIPEVSIACPERMEPITKI
SHIPPSRWALVCNLCKLKTGACIQCSIKSCITAFHVTCAFEHGLEMKTILDEGDEVKFKS
YCLKHSQNRQKLGEAEYPHHRAKEQSQAKSEKTSLRAQKLRELEEEFYSLVRVEDVAAEL
GMPTLAVDFIYNYWKLKRKSNFNKPLFPPKEDEENGLVQPKEESIHTRMRMFMHLRQDLE
RVRNLCYMISRREKLKLSHNKIQEQIFGLQVQLLNQEIDAGLPLTNALENSLFYPPPRIT
LKLKMPKSTPEDHRNSSTETDQQPHSPDSSSSVHSIRNMQVPQESLEMRTKSYPRYPLES
KNNRLLASLSHSRSEAKESSPAWRTPSSECYHGQSLGKPLVLQAALHGQSSIGNGKSQPN
SKFAKSNGLEGSWSGNVTQKDSSSEMFCDQEPVFSPHLVSQGSFRKSTVEHFSRSFKETT
NRWVKNTEDLQCYVKPTKNMSPKEQFWGRQVLRRSAGRAPYQENDGYCPDLELSDSEAES
DGNKEKVRVRKDSSDRENPPHDSRRDCHGKSKTHPLSHSSMQR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92613	0.999	0.999	0.000	823	1.000	1.000	Q92613.pdb.gz	JADE3_HUMAN Protein Jade-3 OS=Homo sapiens OX=9606 GN=JADE3 PE=1 SV=1
2	AFDB:Q6IE81	0.375	0.368	3.563E-67	842	0.456	0.445	Q6IE81.pdb.gz	JADE1_HUMAN Protein Jade-1 OS=Homo sapiens OX=9606 GN=JADE1 PE=1 SV=1
3	AFDB:Q803A0	0.422	0.419	1.306E-63	829	0.428	0.425	Q803A0.pdb.gz	JADE1_DANRE Protein Jade-1 OS=Danio rerio OX=7955 GN=jade1 PE=2 SV=1
4	AFDB:A0A0C4DFT8	0.366	0.379	4.515E-61	791	0.390	0.406	A0A0C4DFT8.pdb.gz	A0A0C4DFT8_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=1
5	AFDB:A0A0B4KGP1	0.192	0.094	4.037E-14	1717	0.165	0.079	A0A0B4KGP1.pdb.gz	A0A0B4KGP1_DROME Alhambra, isoform P OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
6	AFDB:A0A0G2K6I4	0.066	0.090	2.240E-2	564	0.080	0.117	A0A0G2K6I4.pdb.gz	A0A0G2K6I4_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=1 SV=2
7	AFDB:Q99LJ0	0.079	0.097	2.674E-2	638	0.094	0.121	Q99LJ0.pdb.gz	CT2NL_MOUSE CTTNBP2 N-terminal-like protein OS=Mus musculus OX=10090 GN=Cttnbp2nl PE=1 SV=1
8	AFDB:Q1HKZ5	0.085	0.077	3.192E-2	959	0.146	0.125	Q1HKZ5.pdb.gz	M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus OX=10090 GN=Map3k13 PE=1 SV=1
9	AFDB:A0A0G2K7W4	0.095	0.065	3.592E-2	1348	0.112	0.068	A0A0G2K7W4.pdb.gz	A0A0G2K7W4_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=2
10	AFDB:Q99PP7	0.077	0.057	6.878E-2	1142	0.131	0.095	Q99PP7.pdb.gz	TRI33_MOUSE E3 ubiquitin-protein ligase TRIM33 OS=Mus musculus OX=10090 GN=Trim33 PE=1 SV=2
11	PDB:7vvuT	0.073	0.187	1.087	274	0.022	0.066	7vvuT.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
12	PDB:6k15H	0.072	0.134	1.154	393	0.035	0.074	6k15H.pdb.gz	Structure of the RSC complex bound to the nucleosome.
13	PDB:6dv9F	0.041	0.158	1.644	174	0.016	0.075	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
14	PDB:5ds9B	0.043	0.184	2.209	98	0.019	0.163	5ds9B.pdb.gz	DNA Sequence Determinants Controlling Affinity, Stability and Shape of DNA Complexes Bound by the Nucleoid Protein Fis.
15	PDB:6tdaL	0.075	0.100	2.485	596	0.039	0.054	6tdaL.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
16	PDB:2vbwA	0.039	0.169	3.542	147	0.010	0.054	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.
17	PDB:7pzyJ	0.020	0.080	3.757	203	0.004	0.015	7pzyJ.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
18	PDB:7abzX	0.030	0.159	3.986	77	0.017	0.182	7abzX.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
19	PDB:1yioA	0.036	0.138	4.486	198	0.013	0.056	1yioA.pdb.gz	An Active-like Structure in the Unphosphorylated StyR Response Regulator Suggests a Phosphorylation- Dependent Allosteric Activation Mechanism
20	PDB:6wq2A	0.040	0.171	4.486	154	0.016	0.084	6wq2A.pdb.gz	Structures of filamentous viruses infecting hyperthermophilic archaea explain DNA stabilization in extreme environments.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087X085	0.0	607	833	0.363	0.359	A0A087X085_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=2
2	A0A0C4DFT8	0.0	610	791	0.368	0.383	A0A0C4DFT8_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=1
3	G3XAA4	0.0	607	834	0.363	0.359	G3XAA4_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=1
4	Q6IE81	0.0	683	842	0.402	0.393	JADE1_HUMAN Protein Jade-1 OS=Homo sapiens OX=9606 GN=JADE1 PE=1 SV=1
5	Q6ZQF7	0.0	602	829	0.358	0.356	JADE2_MOUSE E3 ubiquitin-protein ligase Jade-2 OS=Mus musculus OX=10090 GN=Jade2 PE=1 SV=2
6	Q803A0	0.0	637	829	0.375	0.373	JADE1_DANRE Protein Jade-1 OS=Danio rerio OX=7955 GN=jade1 PE=2 SV=1
7	Q92613	0.0	1718	823	1.000	1.000	JADE3_HUMAN Protein Jade-3 OS=Homo sapiens OX=9606 GN=JADE3 PE=1 SV=1
8	Q9NQC1	0.0	611	790	0.367	0.382	JADE2_HUMAN E3 ubiquitin-protein ligase Jade-2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=2
9	Q7YZH1	8.23e-159	515	3241	0.305	0.077	RNO_DROME PHD finger protein rhinoceros OS=Drosophila melanogaster OX=7227 GN=rno PE=1 SV=1
10	Q7JVP4	3.65e-69	251	1430	0.188	0.108	BRDH_DROME Bromodomain-containing protein homolog OS=Drosophila melanogaster OX=7227 GN=Br140 PE=1 SV=1
11	A0A5F9ZH11	3.43e-58	218	1253	0.164	0.108	A0A5F9ZH11_HUMAN Bromodomain and PHD finger containing 1 OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
12	P55201	3.56e-58	218	1214	0.166	0.113	BRPF1_HUMAN Peregrin OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
13	B2RRD7	7.58e-58	217	1212	0.170	0.116	BRPF1_MOUSE Peregrin OS=Mus musculus OX=10090 GN=Brpf1 PE=1 SV=1
14	Q803M2	6.21e-57	213	899	0.177	0.162	Q803M2_DANRE Bromodomain and PHD finger containing, 1 OS=Danio rerio OX=7955 GN=zgc:55530 PE=2 SV=1
15	G5E8P1	1.62e-55	209	1058	0.185	0.144	BRD1_MOUSE Bromodomain-containing protein 1 OS=Mus musculus OX=10090 GN=Brd1 PE=1 SV=1
16	D3ZUW8	2.04e-55	209	1189	0.182	0.126	D3ZUW8_RAT Bromodomain containing 1 OS=Rattus norvegicus OX=10116 GN=Brd1 PE=4 SV=3
17	O95696	1.00e-52	201	1058	0.185	0.144	BRD1_HUMAN Bromodomain-containing protein 1 OS=Homo sapiens OX=9606 GN=BRD1 PE=1 SV=1
18	Q12311	8.32e-51	192	748	0.158	0.174	NTO1_YEAST NuA3 HAT complex component NTO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NTO1 PE=1 SV=1
19	Q9ULD4	1.29e-47	186	1205	0.139	0.095	BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens OX=9606 GN=BRPF3 PE=1 SV=2
20	O74759	4.99e-44	172	767	0.147	0.158	NTO1_SCHPO Mst2 complex subunit nto1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nto1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	7.2	17.9	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF10513 EPL1	0.0043	29.1	Enhancer of polycomb-like
3	PF18517 LZ3wCH	0.56	21.6	Leucine zipper with capping helix domain
4	PF00628 PHD	3.9e-07	41.2	PHD-finger
5	PF13831 PHD_2	2.2e-08	44.7	PHD-finger
6	PF14446 Prok-RING_1	25	16.2	Prokaryotic RING finger family 1
7	PF13771 zf-HC5HC2H	1.1e-21	88.2	PHD-like zinc-binding domain
8	PF13832 zf-HC5HC2H_2	2.7e-27	106.5	PHD-zinc-finger like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000481850

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259021	0.978	Histone acetyltransferase KAT7
2	9606.ENSP00000380024	0.947	Inhibitor of growth protein 4
3	9606.ENSP00000362166	0.943	Chromatin modification-related protein MEAF6
4	9606.ENSP00000322142	0.904	Inhibitor of growth protein 5
5	9606.ENSP00000307746	0.694	Zinc finger protein 608
6	9606.ENSP00000351908	0.660	Mitogen-activated protein kinase kinase kinase 5
7	9606.ENSP00000345629	0.616	Mitogen-activated protein kinase kinase kinase 15
8	9606.ENSP00000476955	0.605	Nuclear cap binding protein subunit 2 like
9	9606.ENSP00000300403	0.604	Targeting protein for Xklp2
10	9606.ENSP00000302863	0.560	Olfactory receptor 1L3
11	9606.ENSP00000275884	0.557	DENN domain-containing protein 2A
12	9606.ENSP00000297323	0.555	Adenylate cyclase type 1
13	9606.ENSP00000253669	0.543	HAUS augmin-like complex subunit 8
14	9606.ENSP00000378611	0.536	Rho GTPase-activating protein 24
15	9606.ENSP00000322579	0.530	PHD finger protein 23
16	9606.ENSP00000361143	0.530	Transmembrane protein 164
17	9606.ENSP00000401264	0.515	CTP synthase 2
18	9606.ENSP00000363124	0.512	PHD finger protein 20
19	9606.ENSP00000366273	0.510	Zinc finger protein 157
20	9606.ENSP00000354560	0.507	Kinesin-associated protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.667	catalytic activity
GO:0016740	0.492	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0071704	0.965	organic substance metabolic process
GO:0060255	0.965	regulation of macromolecule metabolic process
GO:0044238	0.960	primary metabolic process
GO:0036211	0.953	protein modification process
GO:0019219	0.952	regulation of nucleobase-containing compound metabolic process
GO:0018193	0.923	peptidyl-amino acid modification
GO:0043543	0.911	protein acylation
GO:0051052	0.907	regulation of DNA metabolic process
GO:0009889	0.906	regulation of biosynthetic process
GO:0010556	0.904	regulation of macromolecule biosynthetic process
GO:0016570	0.902	histone modification
GO:0031326	0.898	regulation of cellular biosynthetic process
GO:0006473	0.892	protein acetylation
GO:0051726	0.876	regulation of cell cycle
GO:0043967	0.875	histone H4 acetylation
GO:2000278	0.779	regulation of DNA biosynthetic process
GO:0006275	0.773	regulation of DNA replication
GO:0009987	0.635	cellular process
GO:0048518	0.476	positive regulation of biological process
GO:0010468	0.400	regulation of gene expression
GO:0051252	0.345	regulation of RNA metabolic process
GO:0048522	0.318	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:1990234	0.996	transferase complex
GO:0000785	0.996	chromatin
GO:0000123	0.990	histone acetyltransferase complex
GO:0005829	0.930	cytosol
GO:0016020	0.314	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.492	Transferases.

[back to server]