StarFunc result for job id Q92614

User Input

>input (2054 residues)
MFNLMKKDKDKDGGRKEKKEKKEKKERMSAAELRSLEEMSLRRGFFNLNRSSKRESKTRL
EISNPIPIKVASGSDLHLTDIDSDSNRGSVILDSGHLSTASSSDDLKGEEGSFRGSVLQR
AAKFGSLAKQNSQMIVKRFSFSQRSRDESASETSTPSEHSAAPSPQVEVRTLEGQLVQHP
GPGIPRPGHRSRAPELVTKKFPVDLRLPPVVPLPPPTLRELELQRRPTGDFGFSLRRTTM
LDRGPEGQACRRVVHFAEPGAGTKDLALGLVPGDRLVEINGHNVESKSRDEIVEMIRQSG
DSVRLKVQPIPELSELSRSWLRSGEGPRREPSDAKTEEQIAAEEAWNETEKVWLVHRDGF
SLASQLKSEELNLPEGKVRVKLDHDGAILDVDEDDVEKANAPSCDRLEDLASLVYLNESS
VLHTLRQRYGASLLHTYAGPSLLVLGPRGAPAVYSEKVMHMFKGCRREDMAPHIYAVAQT
AYRAMLMSRQDQSIILLGSSGSGKTTSCQHLVQYLATIAGISGNKVFSVEKWQALYTLLE
AFGNSPTIINGNATRFSQILSLDFDQAGQVASASIQTMLLEKLRVARRPASEATFNVFYY
LLACGDGTLRTELHLNHLAENNVFGIVPLAKPEEKQKAAQQFSKLQAAMKVLGISPDEQK
ACWFILAAIYHLGAAGATKEAAEAGRKQFARHEWAQKAAYLLGCSLEELSSAIFKHQHKG
GTLQRSTSFRQGPEESGLGDGTGPKLSALECLEGMAAGLYSELFTLLVSLVNRALKSSQH
SLCSMMIVDTPGFQNPEQGGSARGASFEELCHNYTQDRLQRLFHERTFVQELERYKEENI
ELAFDDLEPPTDDSVAAVDQASHQSLVRSLARTDEARGLLWLLEEEALVPGASEDTLLER
LFSYYGPQEGDKKGQSPLLHSSKPHHFLLGHSHGTNWVEYNVTGWLNYTKQNPATQNAPR
LLQDSQKKIISNLFLGRAGSATVLSGSIAGLEGGSQLALRRATSMRKTFTTGMAAVKKKS
LCIQMKLQVDALIDTIKKSKLHFVHCFLPVAEGWAGEPRSASSRRVSSSSELDLPSGDHC
EAGLLQLDVPLLRTQLRGSRLLDAMRMYRQGYPDHMVFSEFRRRFDVLAPHLTKKHGRNY
IVVDERRAVEELLECLDLEKSSCCMGLSRVFFRAGTLARLEEQRDEQTSRNLTLFQAACR
GYLARQHFKKRKIQDLAIRCVQKNIKKNKGVKDWPWWKLFTTVRPLIEVQLSEEQIRNKD
EEIQQLRSKLEKAEKERNELRLNSDRLESRISELTSELTDERNTGESASQLLDAETAERL
RAEKEMKELQTQYDALKKQMEVMEMEVMEARLIRAAEINGEVDDDDAGGEWRLKYERAVR
EVDFTKKRLQQEFEDKLEVEQQNKRQLERRLGDLQADSEESQRALQQLKKKCQRLTAELQ
DTKLHLEGQQVRNHELEKKQRRFDSELSQAHEEAQREKLQREKLQREKDMLLAEAFSLKQ
QLEEKDMDIAGFTQKVVSLEAELQDISSQESKDEASLAKVKKQLRDLEAKVKDQEEELDE
QAGTIQMLEQAKLRLEMEMERMRQTHSKEMESRDEEVEEARQSCQKKLKQMEVQLEEEYE
DKQKVLREKRELEGKLATLSDQVNRRDFESEKRLRKDLKRTKALLADAQLMLDHLKNSAP
SKREIAQLKNQLEESEFTCAAAVKARKAMEVEIEDLHLQIDDIAKAKTALEEQLSRLQRE
KNEIQNRLEEDQEDMNELMKKHKAAVAQASRDLAQINDLQAQLEEANKEKQELQEKLQAL
QSQVEFLEQSMVDKSLVSRQEAKIRELETRLEFERTQVKRLESLASRLKENMEKLTEERD
QRIAAENREKEQNKRLQRQLRDTKEEMGELARKEAEASRKKHELEMDLESLEAANQSLQA
DLKLAFKRIGDLQAAIEDEMESDENEDLINSLQDMVTKYQKRKNKLEGDSDVDSELEDRV
DGVKSWLSKNKGPSKAASDDGSLKSSSPTSYWKSLAPDRSDDEHDPLDNTSRPRYSHSYL
SDSDTEAKLTETNA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4J7R2	0.569	0.479	0.000	2454	0.700	0.586	A0A0R4J7R2.pdb.gz	A0A0R4J7R2_DANRE Myosin XVIIIAa OS=Danio rerio OX=7955 GN=myo18aa PE=3 SV=1
2	AFDB:E7FE29	0.491	0.398	0.000	2557	0.673	0.541	E7FE29.pdb.gz
3	AFDB:E9PV66	0.460	0.368	0.000	2605	0.395	0.312	E9PV66.pdb.gz	E9PV66_MOUSE Myosin XVIIIb OS=Mus musculus OX=10090 GN=Myo18b PE=1 SV=1
4	AFDB:Q8INC3	0.516	0.485	0.000	2194	0.374	0.350	Q8INC3.pdb.gz	Q8INC3_DROME Myosin heavy chain-like, isoform B OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=3 SV=2
5	AFDB:Q8IUG5	0.459	0.372	0.000	2567	0.389	0.311	Q8IUG5.pdb.gz	MY18B_HUMAN Unconventional myosin-XVIIIb OS=Homo sapiens OX=9606 GN=MYO18B PE=1 SV=2
6	AFDB:Q92614	1.000	1.000	0.000	2054	1.000	1.000	Q92614.pdb.gz	MY18A_HUMAN Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A PE=1 SV=3
7	AFDB:O08638	0.376	0.391	4.172E-61	1972	0.209	0.218	O08638.pdb.gz	MYH11_MOUSE Myosin-11 OS=Mus musculus OX=10090 GN=Myh11 PE=1 SV=1
8	AFDB:F1QC64	0.392	0.456	8.823E-60	1749	0.216	0.253	F1QC64.pdb.gz
9	AFDB:Q61879	0.395	0.410	1.984E-59	1976	0.205	0.213	Q61879.pdb.gz	MYH10_MOUSE Myosin-10 OS=Mus musculus OX=10090 GN=Myh10 PE=1 SV=2
10	AFDB:Q62812	0.397	0.415	4.681E-59	1961	0.204	0.214	Q62812.pdb.gz	MYH9_RAT Myosin-9 OS=Rattus norvegicus OX=10116 GN=Myh9 PE=1 SV=3
11	PDB:4pa0A	0.286	0.575	2.188E-46	974	0.109	0.229	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
12	PDB:4pa0B	0.281	0.594	8.897E-44	920	0.106	0.236	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4anjA	0.304	0.605	5.713E-43	995	0.093	0.192	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
14	PDB:7mf3B	0.324	0.706	9.203E-43	896	0.148	0.338	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
15	PDB:4p7hB	0.284	0.585	1.208E-41	952	0.107	0.231	4p7hB.pdb.gz
16	PDB:5tbyA	0.306	0.616	4.377E-41	954	0.139	0.300	5tbyA.pdb.gz
17	PDB:6ycxB	0.319	0.750	1.004E-38	817	0.080	0.202	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
18	PDB:7qqnC	0.057	0.209	1.603E-3	414	0.022	0.111	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:7pc3A	0.038	0.179	2.708E-3	405	0.011	0.054	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
20	PDB:7pcbA	0.048	0.193	3.277E-3	415	0.021	0.104	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4J7R2	0.0	2816	2454	0.688	0.576	A0A0R4J7R2_DANRE Myosin XVIIIAa OS=Danio rerio OX=7955 GN=myo18aa PE=3 SV=1
2	B7ZNF7	0.0	1069	1357	0.294	0.444	B7ZNF7_MOUSE Myo18b protein (Fragment) OS=Mus musculus OX=10090 GN=Myo18b PE=2 SV=1
3	E9PV66	0.0	1345	2605	0.366	0.289	E9PV66_MOUSE Myosin XVIIIb OS=Mus musculus OX=10090 GN=Myo18b PE=1 SV=1
4	Q0KI66	0.0	1162	1923	0.327	0.349	Q0KI66_DROME Myosin heavy chain-like, isoform F OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=3 SV=1
5	Q0KI67	0.0	1228	2160	0.359	0.341	Q0KI67_DROME Myosin heavy chain-like, isoform G OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=3 SV=1
6	Q7K523	0.0	1228	2028	0.372	0.377	Q7K523_DROME GH15471p OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=2 SV=1
7	Q8INC3	0.0	1231	2194	0.359	0.336	Q8INC3_DROME Myosin heavy chain-like, isoform B OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=3 SV=2
8	Q8IUG5	0.0	1327	2567	0.366	0.293	MY18B_HUMAN Unconventional myosin-XVIIIb OS=Homo sapiens OX=9606 GN=MYO18B PE=1 SV=2
9	Q92614	0.0	4200	2054	1.000	1.000	MY18A_HUMAN Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A PE=1 SV=3
10	Q9D4I1	0.0	620	745	0.170	0.470	Q9D4I1_MOUSE Myosin motor domain-containing protein OS=Mus musculus OX=10090 GN=Myo18b PE=2 SV=1
11	Q9JMH9	0.0	3811	2050	0.945	0.947	MY18A_MOUSE Unconventional myosin-XVIIIa OS=Mus musculus OX=10090 GN=Myo18a PE=1 SV=2
12	Q9VEZ0	0.0	1229	2148	0.359	0.343	Q9VEZ0_DROME Myosin heavy chain-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=3 SV=3
13	P35748	9.38e-153	523	1972	0.219	0.228	MYH11_RABIT Myosin-11 OS=Oryctolagus cuniculus OX=9986 GN=MYH11 PE=2 SV=2
14	A6QLN6	6.50e-151	518	1972	0.221	0.230	A6QLN6_BOVIN MYH11 protein OS=Bos taurus OX=9913 GN=MYH11 PE=1 SV=1
15	P35749	2.92e-150	516	1972	0.219	0.228	MYH11_HUMAN Myosin-11 OS=Homo sapiens OX=9606 GN=MYH11 PE=1 SV=3
16	P10587	1.80e-149	514	1979	0.218	0.226	MYH11_CHICK Myosin-11 OS=Gallus gallus OX=9031 GN=MYH11 PE=1 SV=4
17	Q8IH49	1.51e-145	479	920	0.151	0.337	Q8IH49_DROME GH16009p OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=2 SV=1
18	O08638	3.61e-145	501	1972	0.217	0.226	MYH11_MOUSE Myosin-11 OS=Mus musculus OX=10090 GN=Myh11 PE=1 SV=1
19	P35580	3.94e-140	486	1976	0.215	0.224	MYH10_HUMAN Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3
20	Q8VDD5	1.93e-139	484	1960	0.214	0.224	MYH9_MOUSE Myosin-9 OS=Mus musculus OX=10090 GN=Myh9 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	1.1e+02	14.6	AAA ATPase domain
2	PF13245 AAA_19	4.3e+02	12.5	AAA domain
3	PF13401 AAA_22	1.4e+02	14.2	AAA domain
4	PF13479 AAA_24	2.5e+02	12.8	AAA domain
5	PF13481 AAA_25	7.2e+02	11.1	AAA domain
6	PF08614 ATG16	2.4	19.8	Autophagy protein 16 (ATG16)
7	PF00612 IQ	1.9	19.5	IQ calmodulin-binding motif
8	PF00063 Myosin_head	6.9e-110	379.9	Myosin head (motor domain)
9	PF01576 Myosin_tail_1	6.5e-18	75.7	Myosin tail
10	PF10662 PduV-EutP	2.4e+02	12.9	Ethanolamine utilisation - propanediol utilisation
11	PF00595 PDZ	0.00036	32.2	PDZ domain
12	PF17820 PDZ_6	0.0003	32.0	PDZ domain
13	PF03193 RsgA_GTPase	1.1e+02	14.1	RsgA GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000437073

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265070	0.991	Golgi phosphoprotein 3
2	9606.ENSP00000407586	0.916	GTPase HRas
3	9606.ENSP00000256078	0.913	GTPase KRas
4	9606.ENSP00000361048	0.912	Leucine rich adaptor protein 1
5	9606.ENSP00000358548	0.911	GTPase NRas
6	9606.ENSP00000355731	0.861	Serine/threonine-protein kinase MRCK alpha
7	9606.ENSP00000267622	0.837	Thyroid receptor-interacting protein 11
8	9606.ENSP00000271732	0.828	Golgi phosphoprotein 3-like
9	9606.ENSP00000229395	0.822	FGFR1 oncogene partner 2
10	9606.ENSP00000355812	0.816	FGFR1 oncogene partner
11	9606.ENSP00000379658	0.815	Transcription factor ETV6
12	9606.ENSP00000352424	0.740	TGFB1-induced anti-apoptotic factor 1
13	9606.ENSP00000349259	0.730	Spectrin beta chain, non-erythrocytic 1
14	9606.ENSP00000340507	0.711	Transcription intermediary factor 1-alpha
15	9606.ENSP00000479904	0.707	Zinc finger MYM-type protein 2
16	9606.ENSP00000217652	0.703	Myosin regulatory light chain 12A
17	9606.ENSP00000264657	0.668	Signal transducer and activator of transcription 3
18	9606.ENSP00000263967	0.658	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
19	9606.ENSP00000428056	0.658	Phosphatidylinositol 3-kinase regulatory subunit alpha
20	9606.ENSP00000354394	0.655	Signal transducer and activator of transcription 1-alpha/beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051015	1.000	actin filament binding
GO:0043531	1.000	ADP binding
GO:0005524	1.000	ATP binding
GO:0003676	0.995	nucleic acid binding
GO:0003723	0.982	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.961	regulation of cellular process
GO:0050896	0.909	response to stimulus
GO:0016043	0.897	cellular component organization
GO:0006996	0.880	organelle organization
GO:0048518	0.862	positive regulation of biological process
GO:0051239	0.722	regulation of multicellular organismal process
GO:0032879	0.708	regulation of localization
GO:0051716	0.690	cellular response to stimulus
GO:0042221	0.658	response to chemical
GO:0050865	0.657	regulation of cell activation
GO:0030029	0.622	actin filament-based process
GO:0051049	0.608	regulation of transport
GO:0032502	0.596	developmental process
GO:0010256	0.584	endomembrane system organization
GO:0048856	0.575	anatomical structure development
GO:0002682	0.565	regulation of immune system process
GO:0010033	0.558	response to organic substance
GO:0051050	0.552	positive regulation of transport
GO:0048522	0.533	positive regulation of cellular process
GO:0060627	0.474	regulation of vesicle-mediated transport
GO:0048519	0.456	negative regulation of biological process
GO:0050764	0.434	regulation of phagocytosis
GO:0007010	0.399	cytoskeleton organization
GO:0019222	0.370	regulation of metabolic process
GO:0051179	0.362	localization
GO:0048523	0.361	negative regulation of cellular process
GO:0002694	0.341	regulation of leukocyte activation
GO:0060255	0.339	regulation of macromolecule metabolic process
GO:0002684	0.321	positive regulation of immune system process
GO:0009653	0.306	anatomical structure morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005856	0.999	cytoskeleton
GO:0015629	0.989	actin cytoskeleton
GO:0012505	0.983	endomembrane system
GO:0016020	0.975	membrane
GO:0005829	0.960	cytosol
GO:0031982	0.893	vesicle
GO:0032991	0.852	protein-containing complex
GO:0031984	0.718	organelle subcompartment
GO:0005886	0.678	plasma membrane
GO:0005634	0.649	nucleus
GO:0005794	0.627	Golgi apparatus
GO:0042641	0.582	actomyosin
GO:0099080	0.492	supramolecular complex
GO:0098791	0.451	Golgi apparatus subcompartment
GO:0031981	0.430	nuclear lumen
GO:0099512	0.387	supramolecular fiber
GO:0097708	0.385	intracellular vesicle
GO:0005802	0.383	trans-Golgi network
GO:0031410	0.361	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]