StarFunc result for job id Q92616

User Input

>input (2671 residues)
MAADTQVSETLKRFAGKVTTASVKERREILSELGKCVAGKDLPEGAVKGLCKLFCLTLHR
YRDAASRRALQAAIQQLAEAQPEATAKNLLHSLQSSGIGSKAGVPSKSSGSAALLALTWT
CLLVRIVFPSRAKRQGDIWNKLVEVQCLLLLEVLGGSHKHAVDGAVKKLTKLWKENPGLV
EQYLSAILSLEPNQNYAGMLGLLVQFCTSHKEMDVVSQHKSALLDFYMKNILMSKVKPPK
YLLDSCAPLLRYLSHSEFKDLILPTIQKSLLRSPENVIETISSLLASVTLDLSQYAMDIV
KGLAGHLKSNSPRLMDEAVLALRNLARQCSDSSAMESLTKHLFAILGGSEGKLTVVAQKM
SVLSGIGSVSHHVVSGPSSQVLNGIVAELFIPFLQQEVHEGTLVHAVSVLALWCNRFTME
VPKKLTEWFKKAFSLKTSTSAVRHAYLQCMLASYRGDTLLQALDLLPLLIQTVEKAASQS
TQVPTITEGVAAALLLLKLSVADSQAEAKLSSFWQLIVDEKKQVFTSEKFLVMASEDALC
TVLHLTERLFLDHPHRLTGNKVQQYHRALVAVLLSRTWHVRRQAQQTVRKLLSSLGGFKL
AHGLLEELKTVLSSHKVLPLEALVTDAGEVTEAGKAYVPPRVLQEALCVISGVPGLKGDV
TDTEQLAQEMLIISHHPSLVAVQSGLWPALLARMKIDPEAFITRHLDQIIPRMTTQSPLN
QSSMNAMGSLSVLSPDRVLPQLISTITASVQNPALRLVTREEFAIMQTPAGELYDKSIIQ
SAQQDSIKKANMKRENKAYSFKEQIIELELKEEIKKKKGIKEEVQLTSKQKEMLQAQLDR
EAQVRRRLQELDGELEAALGLLDIILAKNPSGLTQYIPVLVDSFLPLLKSPLAAPRIKNP
FLSLAACVMPSRLKALGTLVSHVTLRLLKPECVLDKSWCQEELSVAVKRAVMLLHTHTIT
SRVGKGEPGAAPLSAPAFSLVFPFLKMVLTEMPHHSEEEEEWMAQILQILTVQAQLRASP
NTPPGRVDENGPELLPRVAMLRLLTWVIGTGSPRLQVLASDTLTTLCASSSGDDGCAFAE
QEEVDVLLCALQSPCASVRETVLRGLMELHMVLPAPDTDEKNGLNLLRRLWVVKFDKEEE
IRKLAERLWSMMGLDLQPDLCSLLIDDVIYHEAAVRQAGAEALSQAVARYQRQAAEVMGR
LMEIYQEKLYRPPPVLDALGRVISESPPDQWEARCGLALALNKLSQYLDSSQVKPLFQFF
VPDALNDRHPDVRKCMLDAALATLNTHGKENVNSLLPVFEEFLKNAPNDASYDAVRQSVV
VLMGSLAKHLDKSDPKVKPIVAKLIAALSTPSQQVQESVASCLPPLVPAIKEDAGGMIQR
LMQQLLESDKYAERKGAAYGLAGLVKGLGILSLKQQEMMAALTDAIQDKKNFRRREGALF
AFEMLCTMLGKLFEPYVVHVLPHLLLCFGDGNQYVREAADDCAKAVMSNLSAHGVKLVLP
SLLAALEEESWRTKAGSVELLGAMAYCAPKQLSSCLPNIVPKLTEVLTDSHVKVQKAGQQ
ALRQIGSVIRNPEILAIAPVLLDALTDPSRKTQKCLQTLLDTKFVHFIDAPSLALIMPIV
QRAFQDRSTDTRKMAAQIIGNMYSLTDQKDLAPYLPSVTPGLKASLLDPVPEVRTVSAKA
LGAMVKGMGESCFEDLLPWLMETLTYEQSSVDRSGAAQGLAEVMAGLGVEKLEKLMPEIV
ATASKVDIAPHVRDGYIMMFNYLPITFGDKFTPYVGPIIPCILKALADENEFVRDTALRA
GQRVISMYAETAIALLLPQLEQGLFDDLWRIRFSSVQLLGDLLFHISGVTGKMTTETASE
DDNFGTAQSNKAIITALGVERRNRVLAGLYMGRSDTQLVVRQASLHVWKIVVSNTPRTLR
EILPTLFGLLLGFLASTCADKRTIAARTLGDLVRKLGEKILPEIIPILEEGLRSQKSDER
QGVCIGLSEIMKSTSRDAVLYFSESLVPTARKALCDPLEEVREAAAKTFEQLHSTIGHQA
LEDILPFLLKQLDDEEVSEFALDGLKQVMAIKSRVVLPYLVPKLTTPPVNTRVLAFLSSV
AGDALTRHLGVILPAVMLALKEKLGTPDEQLEMANCQAVILSVEDDTGHRIIIEYLLEAT
RSPEVGMRQAAAIILNIYCSRSKADYTSHLRSLVSGLIRLFNDSSPVVLEESWDALNAIT
KKLDAGNQLALIEELHKEIRLIGNESKGEHVPGFCLPKKGVTSILPVLREGVLTGSPEQK
EEAAKALGLVIRLTSADALRPSVVSITGPLIRILGDRFSWNVKAALLETLSLLLAKVGIA
LKPFLPQLQTTFTKALQDSNRGVRLKAADALGKLISIHIKVDPLFTELLNGIRAMEDPGV
RDTMLQALRFVIQGAGAKVDAVIRKNIVSLLLSMLGHDEDNTRISSAGCLGELCAFLTEE
ELSAVLQQCLLADVSGIDWMVRHGRSLALSVAVNVAPGRLCAGRYSSDVQEMILSSATAD
RIPIAVSGVRGMGFLMRHHIETGGGQLPAKLSSLFVKCLQNPSSDIRLVAEKMIWWANKD
PLPPLDPQAIKPILKALLDNTKDKNTVVRAYSDQAIVNLLKMRQGEEVFQSLSKILDVAS
LEVLNEVNRRSLKKLASQADSTEQVDDTILT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B3CJ34	0.827	0.838	0.000	2634	0.327	0.331	B3CJ34.pdb.gz	B3CJ34_CAEEL TOG domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gcn-1 PE=1 SV=3
2	AFDB:E9PVA8	0.972	0.972	0.000	2671	0.939	0.939	E9PVA8.pdb.gz	GCN1_MOUSE Stalled ribosome sensor GCN1 OS=Mus musculus OX=10090 GN=Gcn1 PE=1 SV=1
3	AFDB:F4I893	0.366	0.363	0.000	2696	0.334	0.331	F4I893.pdb.gz	ILA_ARATH Protein ILITYHIA OS=Arabidopsis thaliana OX=3702 GN=ILA PE=1 SV=1
4	AFDB:P33892	0.535	0.535	0.000	2672	0.278	0.278	P33892.pdb.gz	GCN1_YEAST eIF-2-alpha kinase activator GCN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN1 PE=1 SV=1
5	AFDB:Q10105	0.667	0.667	0.000	2670	0.282	0.282	Q10105.pdb.gz	GCN1_SCHPO eIF-2-alpha kinase activator gcn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn1 PE=3 SV=1
6	AFDB:Q388R9	0.257	0.259	1.554E-49	2651	0.171	0.172	Q388R9.pdb.gz	Q388R9_TRYB2 TOG domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0150 PE=4 SV=1
7	AFDB:Q5VYK3	0.103	0.136	1.040E-21	1845	0.109	0.157	Q5VYK3.pdb.gz	ECM29_HUMAN Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2
8	AFDB:F4I718	0.137	0.157	4.321E-21	2136	0.119	0.149	F4I718.pdb.gz	CSI3_ARATH Protein CELLULOSE SYNTHASE INTERACTIVE 3 OS=Arabidopsis thaliana OX=3702 GN=CSI3 PE=1 SV=1
9	AFDB:O60055	0.119	0.125	6.456E-21	2493	0.128	0.138	O60055.pdb.gz	UTP20_SCHPO U3 small nucleolar RNA-associated protein 20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=utp20 PE=3 SV=1
10	AFDB:P97536	0.120	0.217	1.441E-20	1230	0.077	0.167	P97536.pdb.gz	CAND1_RAT Cullin-associated NEDD8-dissociated protein 1 OS=Rattus norvegicus OX=10116 GN=Cand1 PE=1 SV=1
11	PDB:7mqaSP	0.146	0.151	6.469E-19	2485	0.134	0.144	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7mqaLM	0.108	0.129	1.076E-17	2041	0.112	0.146	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:4a0cA	0.111	0.213	3.722E-17	1155	0.070	0.162	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
14	PDB:7sglA	0.119	0.093	5.362E-17	3852	0.149	0.103	7sglA.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
15	PDB:7sukSP	0.121	0.135	6.675E-17	2234	0.119	0.142	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
16	PDB:7su3A	0.127	0.099	8.309E-17	3802	0.152	0.107	7su3A.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
17	PDB:7ajuUT	0.121	0.131	1.197E-16	2313	0.113	0.130	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
18	PDB:7tyrA	0.114	0.092	1.110E-15	3905	0.145	0.099	7tyrA.pdb.gz
19	PDB:7otmA	0.118	0.096	4.609E-15	3656	0.148	0.108	7otmA.pdb.gz	Structural insights into inhibitor regulation of the DNA repair protein DNA-PKcs.
20	PDB:7mq8LM	0.102	0.121	6.173E-15	2005	0.116	0.155	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B3CJ34	0.0	1252	2634	0.337	0.341	B3CJ34_CAEEL TOG domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gcn-1 PE=1 SV=3
2	C8V020	0.0	929	2672	0.238	0.238	C8V020_EMENI Translational activator, putative (AFU_orthologue AFUA_2G07960) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10734 PE=4 SV=1
3	E9PVA8	0.0	5064	2671	0.940	0.940	GCN1_MOUSE Stalled ribosome sensor GCN1 OS=Mus musculus OX=10090 GN=Gcn1 PE=1 SV=1
4	F4I893	0.0	1164	2696	0.247	0.245	ILA_ARATH Protein ILITYHIA OS=Arabidopsis thaliana OX=3702 GN=ILA PE=1 SV=1
5	P33892	0.0	1006	2672	0.236	0.236	GCN1_YEAST eIF-2-alpha kinase activator GCN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN1 PE=1 SV=1
6	Q10105	0.0	901	2670	0.242	0.242	GCN1_SCHPO eIF-2-alpha kinase activator gcn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn1 PE=3 SV=1
7	Q92616	0.0	5426	2671	1.000	1.000	GCN1_HUMAN Stalled ribosome sensor GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=7
8	Q388R9	1.36e-70	267	2651	0.073	0.074	Q388R9_TRYB2 TOG domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0150 PE=4 SV=1
9	O94489	9.19e-30	132	1047	0.031	0.079	EF3_SCHPO Elongation factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tef3 PE=1 SV=1
10	D0MYB4	4.73e-28	126	1038	0.043	0.111	EF3_PHYIT Elongation factor 3 OS=Phytophthora infestans (strain T30-4) OX=403677 GN=TEF3 PE=1 SV=1
11	O14134	1.65e-26	121	1057	0.033	0.082	ELF1_SCHPO mRNA export factor elf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=elf1 PE=1 SV=1
12	P53978	5.26e-22	107	1044	0.034	0.087	EF3B_YEAST Elongation factor 3B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HEF3 PE=1 SV=2
13	P16521	3.89e-19	97.8	1044	0.031	0.079	EF3A_YEAST Elongation factor 3A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YEF3 PE=1 SV=4
14	O93796	4.49e-19	97.4	1045	0.032	0.081	EF3_CANGA Elongation factor 3 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=TEF3 PE=3 SV=2
15	A0A1D8PTY4	3.33e-12	75.1	1195	0.024	0.054	A0A1D8PTY4_CANAL Elf1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ELF1 PE=3 SV=1
16	Q08972	1.35e-08	63.2	1196	0.025	0.057	NEW1_YEAST [NU+] prion formation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NEW1 PE=1 SV=1
17	Q5BBG0	4.90e-05	51.6	1093	0.021	0.051	Q5BBG0_EMENI Importin subunit beta-4, putative (JCVI) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02120 PE=4 SV=1
18	P49955	2.29e-04	49.3	971	0.042	0.116	SF3B1_YEAST U2 snRNP component HSH155 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSH155 PE=1 SV=1
19	J3KN16	4.77e-04	48.5	2017	0.027	0.036	J3KN16_HUMAN Ecm29 proteasome adaptor and scaffold OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=1
20	Q5VYK3	6.03e-04	48.1	1845	0.027	0.040	ECM29_HUMAN Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00514 Arm	0.43	21.9	Armadillo/beta-catenin-like repeat
2	PF15335 CAAP1	39	16.1	Caspase activity and apoptosis inhibitor 1
3	PF12348 CLASP_N	2.1e-14	65.2	CLASP N terminal
4	PF12717 Cnd1	4.7e-12	57.7	non-SMC mitotic condensation complex subunit 1
5	PF11865 DUF3385	0.00062	31.2	Domain of unknown function (DUF3385)
6	PF20416 DUF6700	0.00045	31.3	Domain of unknown function (DUF6700)
7	PF02985 HEAT	7.6e-41	145.6	HEAT repeat
8	PF13646 HEAT_2	1.1e-34	129.9	HEAT repeats
9	PF13513 HEAT_EZ	5.5e-26	102.0	HEAT-like repeat
10	PF14500 MMS19_N	5.5	18.0	Dos2-interacting transcription regulator of RNA-Pol-II
11	PF10274 ParcG	0.0023	29.6	Parkin co-regulated protein
12	PF14666 RICTOR_M	3.5e+02	12.3	Rapamycin-insensitive companion of mTOR, middle domain
13	PF12612 TFCD_C	24	16.2	Tubulin folding cofactor D C terminal
14	PF08064 UME	3.5e-07	41.4	UME (NUC010) domain
15	PF12755 Vac14_Fab1_bd	1.7e-12	59.1	Vacuolar 14 Fab1-binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300648

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263791	0.997	eIF-2-alpha kinase GCN2
2	9606.ENSP00000411471	0.993	ATP-binding cassette sub-family F member 3
3	9606.ENSP00000425634	0.927	Histidine--tRNA ligase, cytoplasmic
4	9606.ENSP00000284202	0.901	Protein IMPACT
5	9606.ENSP00000420357	0.901	RWD domain-containing protein 1
6	9606.ENSP00000360532	0.877	Cell division cycle 5-like protein
7	9606.ENSP00000225729	0.859	Developmentally-regulated GTP-binding protein 2
8	9606.ENSP00000258962	0.858	Serine/arginine-rich splicing factor 1
9	9606.ENSP00000358812	0.829	Protein RRP5 homolog
10	9606.ENSP00000256383	0.827	Eukaryotic translation initiation factor 2 subunit 1
11	9606.ENSP00000313603	0.826	ATP-binding cassette sub-family F member 1
12	9606.ENSP00000355541	0.822	HEAT repeat-containing protein 1
13	9606.ENSP00000348965	0.815	Cytoplasmic dynein 1 heavy chain 1
14	9606.ENSP00000318861	0.806	Splicing factor 3B subunit 2
15	9606.ENSP00000335321	0.806	Splicing factor 3B subunit 1
16	9606.ENSP00000326261	0.795	Serine/arginine repetitive matrix protein 1
17	9606.ENSP00000342374	0.794	Small nuclear ribonucleoprotein Sm D2
18	9606.ENSP00000300413	0.793	Small nuclear ribonucleoprotein Sm D1
19	9606.ENSP00000370377	0.768	Presequence protease, mitochondrial
20	9606.ENSP00000327179	0.767	U3 small nucleolar RNA-associated protein 4 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	1.000	nucleic acid binding
GO:0045182	0.997	translation regulator activity
GO:0008494	0.985	translation activator activity
GO:0003723	0.941	RNA binding
GO:0050839	0.888	cell adhesion molecule binding
GO:0045296	0.817	cadherin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:1990928	0.992	response to amino acid starvation
GO:0009267	0.991	cellular response to starvation
GO:0034198	0.976	cellular response to amino acid starvation
GO:0071704	0.653	organic substance metabolic process
GO:0044238	0.614	primary metabolic process
GO:0044237	0.614	cellular metabolic process
GO:0006807	0.611	nitrogen compound metabolic process
GO:0043170	0.582	macromolecule metabolic process
GO:0065007	0.565	biological regulation
GO:0050789	0.559	regulation of biological process
GO:0050794	0.551	regulation of cellular process
GO:0034641	0.382	cellular nitrogen compound metabolic process
GO:0010467	0.351	gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.992	protein-containing complex
GO:0016020	0.991	membrane
GO:0005654	0.955	nucleoplasm
GO:0043232	0.950	intracellular non-membrane-bounded organelle
GO:1990904	0.913	ribonucleoprotein complex
GO:0005844	0.650	polysome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]