StarFunc result for job id Q92617

User Input

>input (1050 residues)
MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRKVINTLADHHHRGTDFGGSPW
LHVIIAFPTSYKVVITLWIVYLWVSLLKTIFWSRNGHDGSTDVQQRAWRSNRRRQEGLRS
ICMHTKKRVSSFRGNKIGLKDVITLRRHVETKVRAKIRKRKVTTKINHHDKINGKRKTAR
KQKMFQRAQELRRRAEDYHKCKIPPSARKALCNWVRMAAAEHRHSSGLPYWPYLTAETLK
NRMGHQPPPPTQQHSITDNSLSLKTPPECLLTPLPPSADDNLKTPPECVLTPLPPSADDN
LKTPPECVLTPLPPSADDNLKTPPECLLTPLPPSADDNLKTPPECLLTPLPPSALPSAPP
SADDNLKTRAECLLHPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLRGPLP
PSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLRGPLPPSADDNLKTPSERQLTPL
PPSAPPSADDNIKTPAERLRGPLPPSADDNLKTPSERQLTALPPSADDNIKTPAERLRGP
LPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAFHPQRMIISRHLPSVSSLPFHPQL
HPQQMIISRHLPSVCGGRFHPQQMIISRHLPSVSSLPFHPQLHPQQMIISRHLPSVCGGR
FHPQRMIISRHLPSVSSLPFHPQLHPQQMIISRHLPSVCGGRFHPQQMIISRHLPSVSSL
PFHPQLHPQQMIISRHLPSVCGGRFHPQRMIISRHLPSVSSLPFHPQLHPQQMIISRHLP
SVCGERLRGPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLRGPLPPSADDN
LKTPSERQLTPLPPSAPPSADDNIKTPAERLRGPLPPSADDNLKTPSERQLTPLPPSAPP
SADDNIKTPAERLRGPLPPSADDNLKTPPLATQEAEAEKPRKPKRQRAAEMEPPPEPKRR
RVGDVEPSRKPKRRRAADVEPSSPEPKRRRVGDVEPSRKPKRRRAADVEPSSPEPKRRRV
GDVEPSRKPKRRRAADVEPSLPEPKRRRLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:C9JG80	0.295	0.277	0.000	1138	0.995	0.918	C9JG80.pdb.gz	NPIB4_HUMAN Nuclear pore complex-interacting protein family member B4 OS=Homo sapiens OX=9606 GN=NPIPB4 PE=3 SV=2
2	AFDB:Q92617	1.000	1.000	0.000	1050	1.000	1.000	Q92617.pdb.gz	NPIB3_HUMAN Nuclear pore complex-interacting protein family member B3 OS=Homo sapiens OX=9606 GN=NPIPB3 PE=1 SV=5
3	AFDB:F8W0I5	0.311	0.345	1.518E-98	928	0.874	0.989	F8W0I5.pdb.gz	NPB12_HUMAN Nuclear pore complex-interacting protein family member B12 OS=Homo sapiens OX=9606 GN=NPIPB12 PE=3 SV=2
4	AFDB:E5RHQ5	0.179	0.163	1.556E-97	1161	0.936	0.847	E5RHQ5.pdb.gz	NPB11_HUMAN Nuclear pore complex-interacting protein family member B11 OS=Homo sapiens OX=9606 GN=NPIPB11 PE=3 SV=1
5	AFDB:A6NJU9	0.193	0.180	4.843E-96	1138	0.955	0.881	A6NJU9.pdb.gz	NPB13_HUMAN Nuclear pore complex-interacting protein family member B13 OS=Homo sapiens OX=9606 GN=NPIPB13 PE=3 SV=4
6	AFDB:A1Z8P9	0.046	0.024	1.396E-3	2346	0.114	0.051	A1Z8P9.pdb.gz	TPR_DROME Nucleoprotein TPR OS=Drosophila melanogaster OX=7227 GN=Mtor PE=1 SV=1
7	AFDB:Q9C105	0.076	0.067	1.917E-3	1236	0.086	0.073	Q9C105.pdb.gz	YKT4_SCHPO Chitinase-like protein PB1E7.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAPB1E7.04c PE=3 SV=1
8	AFDB:Q54G14	0.051	0.050	4.470E-3	1081	0.090	0.087	Q54G14.pdb.gz	Y0266_DICDI Uncharacterized protein DDB_G0290685 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0290685 PE=2 SV=2
9	AFDB:F1RCC9	0.055	0.050	7.998E-3	1179	0.150	0.133	F1RCC9.pdb.gz	F1RCC9_DANRE Synaptopodin 2-like a OS=Danio rerio OX=7955 GN=synpo2la PE=4 SV=2
10	AFDB:P16884	0.054	0.053	8.890E-3	1072	0.154	0.151	P16884.pdb.gz	NFH_RAT Neurofilament heavy polypeptide OS=Rattus norvegicus OX=10116 GN=Nefh PE=1 SV=4
11	PDB:2oi6B	0.068	0.118	1.574E-1	452	0.019	0.044	2oi6B.pdb.gz	Structure of the E. coli bifunctional GlmU acetyltransferase active site with substrates and products.
12	PDB:3eh0A	0.058	0.124	2.463	341	0.015	0.047	3eh0A.pdb.gz
13	PDB:2jf2A	0.059	0.126	2.597	264	0.015	0.061	2jf2A.pdb.gz
14	PDB:5awfA	0.058	0.111	4.408	385	0.020	0.055	5awfA.pdb.gz
15	PDB:7ojpZ	0.048	0.106	4.899	261	0.012	0.050	7ojpZ.pdb.gz	Discovery of Novel UDP- N -Acetylglucosamine Acyltransferase (LpxA) Inhibitors with Activity against Pseudomonas aeruginosa .
16	PDB:7aqqy	0.038	0.082	5.165	268	0.006	0.022	7aqqy.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
17	PDB:7d72A	0.043	0.073	7.480	407	0.012	0.032	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
18	PDB:6hivBC	0.029	0.054	7.886	478	0.012	0.027	6hivBC.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
19	PDB:5l6vI	0.031	0.058	8.766	400	0.012	0.033	5l6vI.pdb.gz	Structural Basis of Glycogen Biosynthesis Regulation in Bacteria.
20	PDB:6uxwA	0.035	0.045	9.744	778	0.030	0.040	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NJU9	0.0	1683	1138	0.951	0.878	NPB13_HUMAN Nuclear pore complex-interacting protein family member B13 OS=Homo sapiens OX=9606 GN=NPIPB13 PE=3 SV=4
2	A8MRT5	0.0	2028	1133	1.000	0.927	NPIB5_HUMAN Nuclear pore complex-interacting protein family member B5 OS=Homo sapiens OX=9606 GN=NPIPB5 PE=2 SV=3
3	C9JG80	0.0	2017	1138	0.995	0.918	NPIB4_HUMAN Nuclear pore complex-interacting protein family member B4 OS=Homo sapiens OX=9606 GN=NPIPB4 PE=3 SV=2
4	E5RHQ5	0.0	1618	1161	0.913	0.826	NPB11_HUMAN Nuclear pore complex-interacting protein family member B11 OS=Homo sapiens OX=9606 GN=NPIPB11 PE=3 SV=1
5	E9PKP1	0.0	1182	595	0.567	1.000	E9PKP1_HUMAN Nuclear pore complex interacting protein family member B5 (Fragment) OS=Homo sapiens OX=9606 GN=NPIPB5 PE=3 SV=1
6	F5H4N5	0.0	745	358	0.341	1.000	F5H4N5_HUMAN Nuclear pore complex interacting protein family member B3 (Fragment) OS=Homo sapiens OX=9606 GN=NPIPB3 PE=3 SV=1
7	F6SDX0	0.0	1182	595	0.567	1.000	F6SDX0_HUMAN Nuclear pore complex interacting protein family member B5 (Fragment) OS=Homo sapiens OX=9606 GN=NPIPB5 PE=3 SV=1
8	F8W0I5	0.0	1023	928	0.604	0.683	NPB12_HUMAN Nuclear pore complex-interacting protein family member B12 OS=Homo sapiens OX=9606 GN=NPIPB12 PE=3 SV=2
9	Q92617	0.0	2071	1050	1.000	1.000	NPIB3_HUMAN Nuclear pore complex-interacting protein family member B3 OS=Homo sapiens OX=9606 GN=NPIPB3 PE=1 SV=5
10	E9PQR5	6.99e-175	520	432	0.274	0.667	NPIB8_HUMAN Nuclear pore complex-interacting protein family member B8 OS=Homo sapiens OX=9606 GN=NPIPB8 PE=3 SV=1
11	E9PJ23	4.36e-172	512	425	0.260	0.642	NPIB6_HUMAN Nuclear pore complex-interacting protein family member B6 OS=Homo sapiens OX=9606 GN=NPIPB6 PE=3 SV=1
12	E9PNV8	3.48e-161	482	369	0.253	0.721	E9PNV8_HUMAN Nuclear pore complex interacting protein family member A3 OS=Homo sapiens OX=9606 GN=NPIPA3 PE=3 SV=1
13	E9PIF3	5.68e-154	463	369	0.247	0.702	NPIA2_HUMAN Nuclear pore complex-interacting protein family member A2 OS=Homo sapiens OX=9606 GN=NPIPA2 PE=3 SV=1
14	A6NJ64	1.23e-151	458	397	0.235	0.622	NPIB2_HUMAN Putative nuclear pore complex-interacting protein family member B2 OS=Homo sapiens OX=9606 GN=NPIPB2 PE=5 SV=4
15	A6NHN6	1.05e-144	442	443	0.233	0.553	NPB15_HUMAN Nuclear pore complex-interacting protein family member B15 OS=Homo sapiens OX=9606 GN=NPIPB15 PE=3 SV=3
16	A0A0B4J1W7	4.25e-143	435	369	0.225	0.640	NPIA9_HUMAN Nuclear pore complex-interacting protein family member A9 OS=Homo sapiens OX=9606 GN=NPIPA9 PE=3 SV=1
17	F8W1W9	1.48e-142	436	429	0.236	0.578	NPIB9_HUMAN Nuclear pore complex-interacting protein family member B9 OS=Homo sapiens OX=9606 GN=NPIPB9 PE=3 SV=1
18	I3L0I5	3.47e-141	432	421	0.234	0.584	I3L0I5_HUMAN Nuclear pore complex interacting protein family member B7 (Fragment) OS=Homo sapiens OX=9606 GN=NPIPB7 PE=3 SV=2
19	A0A1B0GW90	4.73e-141	429	370	0.215	0.611	A0A1B0GW90_HUMAN Uncharacterized protein (Fragment) OS=Homo sapiens OX=9606 PE=3 SV=1
20	O75200	1.61e-140	430	414	0.234	0.594	NPIB7_HUMAN Nuclear pore complex-interacting protein family member B7 OS=Homo sapiens OX=9606 GN=NPIPB7 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07337 CagY_M	34	15.5	DC-EC Repeat
2	PF12178 INCENP_N	5.3	18.4	Chromosome passenger complex (CPC) protein INCENP N terminal
3	PF06409 NPIP	1.8e-149	507.8	Nuclear pore complex interacting protein (NPIP)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000440703

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000396234	0.681	DEP domain containing 4
2	9606.ENSP00000328444	0.595	Keratin-associated protein 4-8
3	9606.ENSP00000478606	0.561	Protocadherin beta-9
4	9606.ENSP00000309501	0.558	NACHT and WD repeat domain containing 2
5	9606.ENSP00000485357	0.556	Hemicentin-2
6	9606.ENSP00000380495	0.519	ATP-dependent RNA helicase DDX51
7	9606.ENSP00000249014	0.504	Cdc42 effector protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.603	biological regulation
GO:0009987	0.473	cellular process
GO:0050789	0.363	regulation of biological process
GO:0008152	0.332	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.440	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]