StarFunc result for job id Q92618

User Input

>input (1163 residues)
MDRNREAEMELRRGPSPTRAGRGHEVDGDKATCHTCCICGKSFPFQSSLSQHMRKHTGEK
PYKCPYCDHRASQKGNLKIHIRSHRTGTLIQGHEPEAGEAPLGEMRASEGLDACASPTKS
ASACNRLLNGASQADGARVLNGASQADSGRVLLRSSKKGAEGSACAPGEAKAAVQCSFCK
SQFERKKDLELHVHQAHKPFKCRLCSYATLREESLLSHIERDHITAQGPGSGEACVENGK
PELSPGEFPCEVCGQAFSQTWFLKAHMKKHRGSFDHGCHICGRRFKEPWFLKNHMKAHGP
KTGSKNRPKSELDPIATINNVVQEEVIVAGLSLYEVCAKCGNLFTNLDSLNAHNAIHRRV
EASRTRAPAEEGAEGPSDTKQFFLQCLNLRPSAAGDSCPGTQAGRRVAELDPVNSYQAWQ
LATRGKVAEPAEYLKYGAWDEALAGDVAFDKDRREYVLVSQEKRKREQDAPAAQGPPRKR
ASGPGDPAPAGHLDPRSAARPNRRAAATTGQGKSSECFECGKIFRTYHQMVLHSRVHRRA
RRERDSDGDRAARARCGSLSEGDSASQPSSPGSACAAADSPGSGLADEAAEDSGEEGAPE
PAPGGQPRRCCFSEEVTSTELSSGDQSHKMGDNASERDTGESKAGIAASVSILENSSRET
SRRQEQHRFSMDLKMPAFHPKQEVPVPGDGVEFPSSTGAEGQTGHPAEKLSDLHNKEHSG
GGKRALAPDLMPLDLSARSTRDDPSNKETASSLQAALVVHPCPYCSHKTYYPEVLWMHKR
IWHRVSCNSVAPPWIQPNGYKSIRSNLVFLSRSGRTGPPPALGGKECQPLLLARFTRTQV
PGGMPGSKSGSSPLGVVTKAASMPKNKESHSGGPCALWAPGPDGYRQTKPCHGQEPHGAA
TQGPLAKPRQEASSKPVPAPGGGGFSRSATPTPTVIARAGAQPSANSKPVEKFGVPPAGA
GFAPTNKHSAPDSLKAKFSAQPQGPPPAKGEGGAPPLPPREPPSKAAQELRTLATCAAGS
RGDAALQAQPGVAGAPPVLHSIKQEPVAEGHEKRLDILNIFKTYIPKDFATLYQGWGVSG
PGLEHRGTLRTQARPGEFVCIECGKSFHQPGHLRAHMRAHSVVFESDGPRGSEVHTTSAD
APKQGRDHSNTGTVQTVPLRKGT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7TSH3	0.318	0.319	0.000	1157	0.816	0.820	Q7TSH3.pdb.gz	ZN516_MOUSE Zinc finger protein 516 OS=Mus musculus OX=10090 GN=Znf516 PE=1 SV=1
2	AFDB:Q92618	0.999	0.999	0.000	1163	1.000	1.000	Q92618.pdb.gz	ZN516_HUMAN Zinc finger protein 516 OS=Homo sapiens OX=9606 GN=ZNF516 PE=1 SV=1
3	AFDB:O75362	0.062	0.067	6.018E-28	1048	0.224	0.248	O75362.pdb.gz	ZN217_HUMAN Zinc finger protein 217 OS=Homo sapiens OX=9606 GN=ZNF217 PE=1 SV=1
4	AFDB:B2GM62	0.048	0.049	8.260E-11	1142	0.137	0.139	B2GM62.pdb.gz
5	AFDB:D4A0R1	0.054	0.057	1.823E-10	1090	0.146	0.156	D4A0R1.pdb.gz	D4A0R1_RAT Zinc finger protein, multitype 2 OS=Rattus norvegicus OX=10116 GN=Zfpm2 PE=4 SV=4
6	AFDB:Q13127	0.072	0.076	3.352E-10	1097	0.141	0.149	Q13127.pdb.gz	REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=3
7	AFDB:A0A0R4INF0	0.111	0.085	1.445E-9	1570	0.159	0.118	A0A0R4INF0.pdb.gz	A0A0R4INF0_DANRE Zinc finger and BTB domain-containing 4 OS=Danio rerio OX=7955 GN=zbtb4 PE=4 SV=1
8	AFDB:F1QPM7	0.054	0.057	3.036E-8	1078	0.151	0.163	F1QPM7.pdb.gz
9	AFDB:F1QH64	0.058	0.057	7.656E-7	1225	0.159	0.151	F1QH64.pdb.gz
10	AFDB:Q90ZW5	0.051	0.048	8.648E-7	1261	0.146	0.135	Q90ZW5.pdb.gz	Q90ZW5_CHICK Spalt 2 protein OS=Gallus gallus OX=9031 GN=SAL2 PE=1 SV=1
11	PDB:3w5kB	0.037	0.256	8.078E-3	110	0.027	0.282	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7od1A	0.024	0.050	7.777E-1	430	0.017	0.047	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
13	PDB:7oqcF	0.032	0.093	1.055	267	0.021	0.090	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
14	PDB:6ydhA	0.018	0.219	1.191	62	0.005	0.097	6ydhA.pdb.gz
15	PDB:6o9lQ	0.032	0.069	1.939	430	0.036	0.098	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
16	PDB:2w1tA	0.021	0.104	2.060	175	0.007	0.046	2w1tA.pdb.gz
17	PDB:7uhyD	0.030	0.085	2.473	288	0.019	0.076	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
18	PDB:6htsR	0.020	0.263	2.629	72	0.009	0.153	6htsR.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
19	PDB:3mhhC	0.033	0.254	3.156	93	0.013	0.161	3mhhC.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
20	PDB:7oqyY	0.022	0.178	3.354	92	0.015	0.185	7oqyY.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7TSH3	0.0	1880	1157	0.816	0.820	ZN516_MOUSE Zinc finger protein 516 OS=Mus musculus OX=10090 GN=Znf516 PE=1 SV=1
2	Q92618	0.0	2378	1163	1.000	1.000	ZN516_HUMAN Zinc finger protein 516 OS=Homo sapiens OX=9606 GN=ZNF516 PE=1 SV=1
3	O15090	1.51e-76	279	1300	0.188	0.168	ZN536_HUMAN Zinc finger protein 536 OS=Homo sapiens OX=9606 GN=ZNF536 PE=1 SV=3
4	Q8K083	3.17e-73	269	1302	0.148	0.132	ZN536_MOUSE Zinc finger protein 536 OS=Mus musculus OX=10090 GN=Znf536 PE=1 SV=1
5	O75362	1.15e-58	222	1048	0.132	0.147	ZN217_HUMAN Zinc finger protein 217 OS=Homo sapiens OX=9606 GN=ZNF217 PE=1 SV=1
6	Q6IQX8	1.84e-39	160	726	0.084	0.135	ZN219_MOUSE Zinc finger protein 219 OS=Mus musculus OX=10090 GN=Znf219 PE=1 SV=1
7	Q9P2Y4	6.80e-39	158	722	0.085	0.137	ZN219_HUMAN Zinc finger protein 219 OS=Homo sapiens OX=9606 GN=ZNF219 PE=1 SV=2
8	F1QQA8	3.98e-35	148	1095	0.089	0.095	ZN219_DANRE Zinc finger protein 219 OS=Danio rerio OX=7955 GN=znf219 PE=1 SV=2
9	Q02386	3.58e-20	99.0	682	0.094	0.160	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
10	P17020	4.11e-20	98.6	682	0.085	0.145	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
11	Q9EQB9	1.76e-19	97.1	759	0.079	0.121	ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus OX=10090 GN=Znf287 PE=2 SV=2
12	Q15937	1.17e-18	93.2	498	0.082	0.191	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
13	Q5TYW1	1.60e-18	94.4	1059	0.077	0.085	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
14	O61362	2.57e-18	93.2	756	0.064	0.099	O61362_DROME CROL GAMMA OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
15	P51523	2.70e-18	93.2	738	0.088	0.138	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
16	M9PCY3	3.12e-18	93.2	878	0.064	0.085	M9PCY3_DROME Crooked legs, isoform G OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
17	P17097	5.11e-18	92.0	686	0.083	0.140	ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens OX=9606 GN=ZNF7 PE=1 SV=1
18	E9Q981	5.12e-18	92.0	636	0.087	0.159	E9Q981_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
19	A0A087WSF4	5.16e-18	91.7	635	0.087	0.159	A0A087WSF4_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
20	Q6NX49	5.39e-18	92.0	715	0.078	0.127	ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens OX=9606 GN=ZNF544 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	9.4e-22	87.3	Zinc finger, C2H2 type
2	PF12756 zf-C2H2_2	11	17.7	C2H2 type zinc-finger (2 copies)
3	PF13894 zf-C2H2_4	2.1e-15	67.1	C2H2-type zinc finger
4	PF13912 zf-C2H2_6	14	17.0	C2H2-type zinc finger
5	PF05605 zf-Di19	3.8	19.2	Drought induced 19 protein (Di19), zinc-binding
6	PF13465 zf-H2C2_2	5e-05	34.7	Zinc-finger double domain
7	PF13909 zf-H2C2_5	0.0035	28.3	C2H2-type zinc-finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000394757

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383042	0.935	Lysine-specific histone demethylase 1A
2	9606.ENSP00000270722	0.866	PR domain zinc finger protein 16
3	9606.ENSP00000290921	0.841	C-terminal-binding protein 1
4	9606.ENSP00000305696	0.751	Putative ribosome-binding factor A, mitochondrial
5	9606.ENSP00000362649	0.740	Histone deacetylase 1
6	9606.ENSP00000380880	0.723	PQ-loop repeat-containing protein 1
7	9606.ENSP00000269601	0.695	Thioredoxin-like protein 4A
8	9606.ENSP00000262241	0.661	REST corepressor 1
9	9606.ENSP00000311825	0.636	C-terminal-binding protein 2
10	9606.ENSP00000360138	0.634	Ligand-dependent corepressor
11	9606.ENSP00000302177	0.628	Lysophospholipid acyltransferase 2
12	9606.ENSP00000353557	0.626	Solute carrier family 35 member F1
13	9606.ENSP00000261438	0.608	Krueppel-like factor 3
14	9606.ENSP00000462106	0.608	Small integral membrane protein 21
15	9606.ENSP00000383063	0.605	Nuclear receptor-interacting protein 1
16	9606.ENSP00000336724	0.603	TBC1 domain family member 22A
17	9606.ENSP00000235372	0.581	PR domain zinc finger protein 2
18	9606.ENSP00000363891	0.572	Putative sodium-coupled neutral amino acid transporter 10
19	9606.ENSP00000323678	0.565	Prostaglandin reductase 3
20	9606.ENSP00000385610	0.554	RNA-binding E3 ubiquitin-protein ligase MEX3C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.820	nucleic acid binding
GO:0140110	0.751	transcription regulator activity
GO:0003677	0.632	DNA binding
GO:0043565	0.588	sequence-specific DNA binding
GO:0003690	0.468	double-stranded DNA binding
GO:1990837	0.461	sequence-specific double-stranded DNA binding
GO:0001067	0.447	transcription regulatory region nucleic acid binding
GO:0000976	0.442	transcription cis-regulatory region binding
GO:0000977	0.335	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0019222	0.980	regulation of metabolic process
GO:0009889	0.970	regulation of biosynthetic process
GO:0010468	0.970	regulation of gene expression
GO:0051252	0.967	regulation of RNA metabolic process
GO:0006355	0.918	regulation of DNA-templated transcription
GO:0009987	0.903	cellular process
GO:0048518	0.804	positive regulation of biological process
GO:0048519	0.712	negative regulation of biological process
GO:0048522	0.678	positive regulation of cellular process
GO:0048523	0.643	negative regulation of cellular process
GO:0009893	0.612	positive regulation of metabolic process
GO:0051173	0.561	positive regulation of nitrogen compound metabolic process
GO:0010604	0.523	positive regulation of macromolecule metabolic process
GO:0009892	0.482	negative regulation of metabolic process
GO:0006357	0.473	regulation of transcription by RNA polymerase II
GO:0010605	0.461	negative regulation of macromolecule metabolic process
GO:0031324	0.460	negative regulation of cellular metabolic process
GO:0051172	0.457	negative regulation of nitrogen compound metabolic process
GO:0009890	0.446	negative regulation of biosynthetic process
GO:0045892	0.440	negative regulation of DNA-templated transcription
GO:0050896	0.435	response to stimulus
GO:0031325	0.394	positive regulation of cellular metabolic process
GO:0000122	0.392	negative regulation of transcription by RNA polymerase II
GO:0051254	0.363	positive regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0005737	0.727	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]