StarFunc result for job id Q92619

User Input

>input (1136 residues)
MFSRKKRELMKTPSISKKNRAGSPSPQPSGELPRKDGADAVFPGPSLEPPAGSSGVKATG
TLKRPTSLSRHASAAGFPLSGAASWTLGRSHRSPLTAASPGELPTEGAGPDVVEDISHLL
ADVARFAEGLEKLKECVLRDDLLEARRPRAHECLGEALRVMHQIISKYPLLNTVETLTAA
GTLIAKVKAFHYESNNDLEKQEFEKALETIAVAFSSTVSEFLMGEVDSSTLLAVPPGDSS
QSMESLYGPGSEGTPPSLEDCDAGCLPAEEVDVLLQRCEGGVDAALLYAKNMAKYMKDLI
SYLEKRTTLEMEFAKGLQKIAHNCRQSVMQEPHMPLLSIYSLALEQDLEFGHSMVQAVGT
LQTQTFMQPLTLRRLEHEKRRKEIKEAWHRAQRKLQEAESNLRKAKQGYVQRCEDHDKAR
FLVAKAEEEQAGSAPGAGSTATKTLDKRRRLEEEAKNKAEEAMATYRTCVADAKTQKQEL
EDTKVTALRQIQEVIRQSDQTIKSATISYYQMMHMQTAPLPVHFQMLCESSKLYDPGQQY
ASHVRQLQRDQEPDVHYDFEPHVSANAWSPVMRARKSSFNVSDVARPEAAGSPPEEGGCT
EGTPAKDHRAGRGHQVHKSWPLSISDSDSGLDPGPGAGDFKKFERTSSSGTMSSTEELVD
PDGGAGASAFEQADLNGMTPELPVAVPSGPFRHEGLSKAARTHRLRKLRTPAKCRECNSY
VYFQGAECEECCLACHKKCLETLAIQCGHKKLQGRLQLFGQDFSHAARSAPDGVPFIVKK
CVCEIERRALRTKGIYRVNGVKTRVEKLCQAFENGKELVELSQASPHDISNVLKLYLRQL
PEPLISFRLYHELVGLAKDSLKAEAEAKAASRGRQDGSESEAVAVALAGRLRELLRDLPP
ENRASLQYLLRHLRRIVEVEQDNKMTPGNLGIVFGPTLLRPRPTEATVSLSSLVDYPHQA
RVIETLIVHYGLVFEEEPEETPGGQDESSNQRAEVVVQVPYLEAGEAVVYPLQEAAADGC
RESRVVSNDSDSDLEEASELLSSSEASALGHLSFLEQQQSEASLEVASGSHSGSEEQLEA
TAREDGDGDEDGPAQQLSGFNTNQSNNVLQAPLPPMRLRGGRMTLGSCRERQPEFV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CGF1	0.298	0.275	1.427E-55	1266	0.330	0.296	Q8CGF1.pdb.gz	RHG29_MOUSE Rho GTPase-activating protein 29 OS=Mus musculus OX=10090 GN=Arhgap29 PE=1 SV=1
2	AFDB:Q52LW3	0.271	0.245	1.615E-55	1261	0.314	0.283	Q52LW3.pdb.gz	RHG29_HUMAN Rho GTPase-activating protein 29 OS=Homo sapiens OX=9606 GN=ARHGAP29 PE=1 SV=2
3	AFDB:A0A024R7N1	0.240	0.280	2.641E-41	970	0.285	0.334	A0A024R7N1.pdb.gz	A0A024R7N1_HUMAN GMIP (Fragment) OS=Homo sapiens OX=9606 GN=GMIP PE=4 SV=1
4	AFDB:P38339	0.211	0.343	4.115E-15	666	0.112	0.191	P38339.pdb.gz	RGD1_YEAST RHO GTPase-activating protein RGD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RGD1 PE=1 SV=1
5	PDB:3cxlA	0.163	0.446	1.453E-11	402	0.072	0.204	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
6	PDB:1xa6A	0.163	0.447	4.601E-11	399	0.073	0.208	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
7	AFDB:Q2M1Z3	0.162	0.129	4.933E-9	1444	0.081	0.064	Q2M1Z3.pdb.gz	RHG31_HUMAN Rho GTPase-activating protein 31 OS=Homo sapiens OX=9606 GN=ARHGAP31 PE=1 SV=2
8	AFDB:D4A9G6	0.167	0.145	5.357E-9	1310	0.073	0.063	D4A9G6.pdb.gz	D4A9G6_RAT Rho GTPase activating protein 33 OS=Rattus norvegicus OX=10116 GN=Arhgap33 PE=1 SV=4
9	PDB:5c2kA	0.150	0.432	2.304E-8	382	0.055	0.165	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
10	PDB:6r3vA	0.160	0.858	2.502E-8	198	0.055	0.313	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
11	AFDB:A6X8Z5	0.166	0.133	3.019E-8	1425	0.076	0.060	A6X8Z5.pdb.gz	RHG31_MOUSE Rho GTPase-activating protein 31 OS=Mus musculus OX=10090 GN=Arhgap31 PE=1 SV=1
12	AFDB:A0A1D8PQG5	0.157	0.283	5.155E-8	615	0.069	0.127	A0A1D8PQG5.pdb.gz	A0A1D8PQG5_CANAL Sac7p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SAC7 PE=4 SV=1
13	PDB:5jcpA	0.142	0.432	2.509E-7	361	0.042	0.133	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
14	AFDB:Q12128	0.165	0.430	2.788E-7	409	0.056	0.156	Q12128.pdb.gz	BAG7_YEAST Rho-GTPase-activating protein BAG7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BAG7 PE=1 SV=1
15	AFDB:Q9VIS1	0.160	0.100	4.038E-7	1843	0.076	0.047	Q9VIS1.pdb.gz	CDGAP_DROME GTPase-activating protein CdGAPr OS=Drosophila melanogaster OX=7227 GN=CdGAPr PE=1 SV=2
16	PDB:6ikoA	0.194	0.616	1.023E-4	303	0.040	0.149	6ikoA.pdb.gz
17	PDB:3hajA	0.164	0.522	1.752E-3	286	0.032	0.126	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
18	PDB:7rraA	0.059	0.100	5.338E-2	602	0.048	0.090	7rraA.pdb.gz
19	PDB:4o9yA	0.072	0.041	1.167E-1	2490	0.048	0.022	4o9yA.pdb.gz
20	PDB:5mkkA	0.060	0.105	1.434E-1	593	0.038	0.073	5mkkA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F5H1R4	0.0	2048	1019	0.877	0.977	F5H1R4_HUMAN Rho GTPase activating protein 45 OS=Homo sapiens OX=9606 GN=ARHGAP45 PE=1 SV=1
2	K7EM85	0.0	2317	1163	1.000	0.977	K7EM85_HUMAN Rho GTPase activating protein 45 OS=Homo sapiens OX=9606 GN=ARHGAP45 PE=1 SV=1
3	K7ES92	0.0	1524	771	0.652	0.961	K7ES92_HUMAN Rho GTPase activating protein 45 OS=Homo sapiens OX=9606 GN=ARHGAP45 PE=1 SV=1
4	K7ES98	0.0	2274	1140	0.979	0.975	K7ES98_HUMAN Rho GTPase activating protein 45 OS=Homo sapiens OX=9606 GN=ARHGAP45 PE=1 SV=1
5	Q52LW3	0.0	600	1261	0.305	0.275	RHG29_HUMAN Rho GTPase-activating protein 29 OS=Homo sapiens OX=9606 GN=ARHGAP29 PE=1 SV=2
6	Q8CGF1	0.0	603	1266	0.311	0.279	RHG29_MOUSE Rho GTPase-activating protein 29 OS=Mus musculus OX=10090 GN=Arhgap29 PE=1 SV=1
7	Q92619	0.0	2333	1136	1.000	1.000	HMHA1_HUMAN Rho GTPase-activating protein 45 OS=Homo sapiens OX=9606 GN=ARHGAP45 PE=1 SV=2
8	A0A024R7N1	6.83e-141	452	970	0.277	0.325	A0A024R7N1_HUMAN GMIP (Fragment) OS=Homo sapiens OX=9606 GN=GMIP PE=4 SV=1
9	Q9P107	6.83e-141	452	970	0.277	0.325	GMIP_HUMAN GEM-interacting protein OS=Homo sapiens OX=9606 GN=GMIP PE=1 SV=2
10	G5EF80	1.64e-38	158	966	0.089	0.105	G5EF80_CAEEL F-BAR domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=spv-1 PE=1 SV=1
11	Q03070	1.72e-34	136	295	0.078	0.302	CHIO_RAT Beta-chimaerin OS=Rattus norvegicus OX=10116 GN=Chn2 PE=2 SV=1
12	P52757	2.99e-32	134	468	0.078	0.190	CHIO_HUMAN Beta-chimaerin OS=Homo sapiens OX=9606 GN=CHN2 PE=1 SV=2
13	P30337	7.89e-32	129	334	0.077	0.260	CHIN_RAT N-chimaerin OS=Rattus norvegicus OX=10116 GN=Chn1 PE=1 SV=2
14	Q7ZUT6	4.85e-31	130	459	0.077	0.192	Q7ZUT6_DANRE Chimerin (Chimaerin) 1 OS=Danio rerio OX=7955 GN=chimaerin PE=1 SV=1
15	Q91V57	7.70e-31	129	459	0.077	0.192	CHIN_MOUSE N-chimaerin OS=Mus musculus OX=10090 GN=Chn1 PE=1 SV=2
16	P15882	1.33e-30	129	459	0.077	0.192	CHIN_HUMAN N-chimaerin OS=Homo sapiens OX=9606 GN=CHN1 PE=1 SV=3
17	Q9W4A9	6.48e-29	124	494	0.073	0.168	Q9W4A9_DROME Rho GTPase activating protein at 5A, isoform A OS=Drosophila melanogaster OX=7227 GN=RhoGAP5A PE=4 SV=1
18	Q12979	2.90e-27	122	859	0.070	0.092	ABR_HUMAN Active breakpoint cluster region-related protein OS=Homo sapiens OX=9606 GN=ABR PE=1 SV=2
19	Q5SSL4	4.03e-27	121	859	0.069	0.091	ABR_MOUSE Active breakpoint cluster region-related protein OS=Mus musculus OX=10090 GN=Abr PE=1 SV=1
20	A0A0G2JTR4	4.24e-27	121	859	0.069	0.091	ABR_RAT Active breakpoint cluster region-related protein OS=Rattus norvegicus OX=10116 GN=Abr PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	0.049	24.8	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF00611 FCH	0.047	25.4	Fes/CIP4, and EFC/F-BAR homology domain
3	PF00620 RhoGAP	3e-45	165.2	RhoGAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000439601

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340975	0.741	Ankyrin repeat domain-containing protein SOWAHD
2	9606.ENSP00000325895	0.730	Ankyrin repeat and death domain containing 1A
3	9606.ENSP00000358902	0.710	Sterile alpha motif domain containing 10
4	9606.ENSP00000356033	0.683	T-cell activation Rho GTPase-activating protein
5	9606.ENSP00000360200	0.675	InaD-like protein
6	9606.ENSP00000353942	0.664	Dynein regulatory complex subunit 7
7	9606.ENSP00000362107	0.660	Four and a half LIM domains 3
8	9606.ENSP00000377558	0.649	Keratin, type I cuticular Ha5
9	9606.ENSP00000380982	0.644	Pumilio homolog 3
10	9606.ENSP00000368688	0.625	Complex III assembly factor LYRM7
11	9606.ENSP00000258787	0.621	Unconventional myosin-Ig
12	9606.ENSP00000344446	0.616	FYVE, RhoGEF and PH domain-containing protein 6
13	9606.ENSP00000432305	0.593	Sperm surface protein Sp17
14	9606.ENSP00000338671	0.583	Rho-related BTB domain-containing protein 1
15	9606.ENSP00000355385	0.560	R3H domain containing 4
16	9606.ENSP00000376553	0.556	Transmembrane protein 119
17	9606.ENSP00000437188	0.553	T-lymphoma invasion and metastasis-inducing protein 2
18	9606.ENSP00000386862	0.548	SH3 domain-binding protein 4
19	9606.ENSP00000389631	0.547	Actin-related protein 2/3 complex subunit 1B
20	9606.ENSP00000355837	0.534	Calpain-8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005096	0.999	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0048583	0.992	regulation of response to stimulus
GO:0010646	0.934	regulation of cell communication
GO:0023051	0.933	regulation of signaling
GO:0051056	0.872	regulation of small GTPase mediated signal transduction
GO:0009987	0.795	cellular process
GO:0050896	0.536	response to stimulus
GO:0051716	0.464	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	1.000	cytosol
GO:0043226	0.801	organelle
GO:0043227	0.712	membrane-bounded organelle
GO:0043229	0.703	intracellular organelle
GO:0043231	0.407	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]