StarFunc result for job id Q92620

User Input

>input (1227 residues)
MGDTSEDASIHRLEGTDLDCQVGGLICKSKSAASEQHVFKAPAPRPSLLGLDLLASLKRR
EREEKDDGEDKKKSKVSSYKDWEESKDDQKDAEEEGGDQAGQNIRKDRHYRSARVETPSH
PGGVSEEFWERSRQRERERREHGVYASSKEEKDWKKEKSRDRDYDRKRDRDERDRSRHSS
RSERDGGSERSSRRNEPESPRHRPKDAATPSRSTWEEEDSGYGSSRRSQWESPSPTPSYR
DSERSHRLSTRDRDRSVRGKYSDDTPLPTPSYKYNEWADDRRHLGSTPRLSRGRGRREEG
EEGISFDTEEERQQWEDDQRQADRDWYMMDEGYDEFHNPLAYSSEDYVRRREQHLHKQKQ
KRISAQRRQINEDNERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLVPPFLDGR
IVFTKQPEPVIPVKDATSDLAIIARKGSQTVRKHREQKERKKAQHKHWELAGTKLGDIMG
VKKEEEPDKAVTEDGKVDYRTEQKFADHMKRKSEASSEFAKKKSILEQRQYLPIFAVQQE
LLTIIRDNSIVIVVGETGSGKTTQLTQYLHEDGYTDYGMIGCTQPRRVAAMSVAKRVSEE
MGGNLGEEVGYAIRFEDCTSENTLIKYMTDGILLRESLREADLDHYSAIIMDEAHERSLN
TDVLFGLLREVVARRSDLKLIVTSATMDAEKFAAFFGNVPIFHIPGRTFPVDILFSKTPQ
EDYVEAAVKQSLQVHLSGAPGDILIFMPGQEDIEVTSDQIVEHLEELENAPALAVLPIYS
QLPSDLQAKIFQKAPDGVRKCIVATNIAETSLTVDGIMFVIDSGYCKLKVFNPRIGMDAL
QIYPISQANANQRSGRAGRTGPGQCFRLYTQSAYKNELLTTTVPEIQRTNLANVVLLLKS
LGVQDLLQFHFMDPPPEDNMLNSMYQLWILGALDNTGGLTSTGRLMVEFPLDPALSKMLI
VSCDMGCSSEILLIVSMLSVPAIFYRPKGREEESDQIREKFAVPESDHLTYLNVYLQWKN
NNYSTIWCNDHFIHAKAMRKVREVRAQLKDIMVQQRMSLASCGTDWDIVRKCICAAYFHQ
AAKLKGIGEYVNIRTGMPCHLHPTSSLFGMGYTPDYIVYHELVMTTKEYMQCVTAVDGEW
LAELGPMFYSVKQAGKSRQENRRRAKEEASAMEEEMALAEEQLRARRQEQEKRSPLGSVR
STKIYTPGRKEQGEPMTPRRTPARFGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F4K2E9	0.669	0.654	0.000	1255	0.509	0.498	F4K2E9.pdb.gz	PRP16_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH7 OS=Arabidopsis thaliana OX=3702 GN=CUV PE=1 SV=1
2	AFDB:Q92620	1.000	1.000	0.000	1227	1.000	1.000	Q92620.pdb.gz	PRP16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens OX=9606 GN=DHX38 PE=1 SV=2
3	AFDB:Q9VY54	0.676	0.679	0.000	1222	0.617	0.619	Q9VY54.pdb.gz	Q9VY54_DROME LD24737p OS=Drosophila melanogaster OX=7227 GN=Prp16 PE=1 SV=2
4	PDB:5yzgZ	0.474	0.895	1.088E-89	635	0.517	0.998	5yzgZ.pdb.gz	Structure of a human catalytic step I spliceosome
5	AFDB:P24384	0.567	0.606	5.873E-88	1145	0.299	0.321	P24384.pdb.gz	PRP22_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRP22 PE=1 SV=1
6	AFDB:Q38953	0.585	0.614	1.334E-85	1168	0.352	0.370	Q38953.pdb.gz	DEAH5_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 OS=Arabidopsis thaliana OX=3702 GN=At3g26560 PE=1 SV=2
7	AFDB:Q8VY00	0.508	0.595	1.724E-82	1044	0.297	0.349	Q8VY00.pdb.gz	ESP3_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1 OS=Arabidopsis thaliana OX=3702 GN=ESP3 PE=1 SV=1
8	AFDB:Q10752	0.506	0.587	2.856E-80	1055	0.293	0.341	Q10752.pdb.gz	CDC28_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein cdc28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc28 PE=3 SV=2
9	AFDB:D3ZD97	0.496	0.757	3.666E-74	795	0.262	0.404	D3ZD97.pdb.gz	D3ZD97_RAT RNA helicase OS=Rattus norvegicus OX=10116 GN=Dhx15 PE=3 SV=1
10	AFDB:O42945	0.494	0.814	7.272E-74	735	0.246	0.411	O42945.pdb.gz	DHX15_SCHPO Probable pre-mRNA-splicing factor ATP-dependent RNA helicase prp43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp43 PE=3 SV=1
11	AFDB:O22899	0.493	0.821	8.977E-74	729	0.254	0.428	O22899.pdb.gz	PRP43_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH3 OS=Arabidopsis thaliana OX=3702 GN=At2g47250 PE=2 SV=1
12	PDB:5xjcY	0.480	0.809	1.028E-72	713	0.282	0.485	5xjcY.pdb.gz	An Atomic Structure of the Human Spliceosome
13	PDB:5wsge	0.470	0.821	4.882E-70	679	0.284	0.513	5wsge.pdb.gz	Structure of a yeast step II catalytically activated spliceosome
14	PDB:6ff7q	0.474	0.903	7.964E-69	625	0.269	0.528	6ff7q.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
15	PDB:5ylzW	0.481	0.819	1.349E-68	703	0.260	0.454	5ylzW.pdb.gz	Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae
16	PDB:6id1V	0.480	0.869	1.907E-66	663	0.237	0.439	6id1V.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
17	PDB:3kx2B	0.480	0.764	3.644E-65	755	0.241	0.392	3kx2B.pdb.gz	Structural basis for the function of DEAH helicases
18	PDB:7dcpx	0.468	0.831	5.516E-62	670	0.229	0.419	7dcpx.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
19	PDB:7dvqx	0.444	0.883	6.416E-59	599	0.256	0.524	7dvqx.pdb.gz	Structure of the activated human minor spliceosome.
20	PDB:5gm6Y	0.452	0.902	6.925E-54	598	0.221	0.453	5gm6Y.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A1Z9L3	752	1242	0.315	0.312	DHX8_DROME ATP-dependent RNA helicase DHX8 OS=Drosophila melanogaster OX=7227 GN=pea PE=1 SV=1
2	A2ACQ1	578	703	0.237	0.414	A2ACQ1_MOUSE RNA helicase OS=Mus musculus OX=10090 GN=Dhx35 PE=1 SV=1
3	D3ZD97	593	795	0.247	0.381	D3ZD97_RAT RNA helicase OS=Rattus norvegicus OX=10116 GN=Dhx15 PE=3 SV=1
4	F4IJV4	718	1044	0.269	0.316	DEAH6_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6 OS=Arabidopsis thaliana OX=3702 GN=MEE29 PE=2 SV=1
5	F4K2E9	1174	1255	0.521	0.509	PRP16_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH7 OS=Arabidopsis thaliana OX=3702 GN=CUV PE=1 SV=1
6	F5H658	716	1181	0.296	0.307	F5H658_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DHX8 PE=1 SV=1
7	O22899	635	729	0.254	0.428	PRP43_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH3 OS=Arabidopsis thaliana OX=3702 GN=At2g47250 PE=2 SV=1
8	O35286	593	795	0.247	0.381	DHX15_MOUSE ATP-dependent RNA helicase DHX15 OS=Mus musculus OX=10090 GN=Dhx15 PE=1 SV=2
9	O42643	741	1168	0.302	0.317	PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp22 PE=1 SV=1
10	O42945	615	735	0.244	0.407	DHX15_SCHPO Probable pre-mRNA-splicing factor ATP-dependent RNA helicase prp43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp43 PE=3 SV=1
11	O43143	593	795	0.247	0.381	DHX15_HUMAN ATP-dependent RNA helicase DHX15 OS=Homo sapiens OX=9606 GN=DHX15 PE=1 SV=2
12	O45244	677	1008	0.269	0.327	DHX16_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 OS=Caenorhabditis elegans OX=6239 GN=mog-4 PE=1 SV=2
13	O60231	722	1041	0.283	0.333	DHX16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens OX=9606 GN=DHX16 PE=1 SV=2
14	P15938	750	1071	0.315	0.360	PRP16_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRP16 PE=1 SV=2
15	P24384	726	1145	0.282	0.302	PRP22_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRP22 PE=1 SV=1
16	P34498	1282	1131	0.523	0.568	MOG1_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 OS=Caenorhabditis elegans OX=6239 GN=mog-1 PE=1 SV=2
17	P53131	598	767	0.244	0.391	PRP43_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRP43 PE=1 SV=1
18	Q09530	746	1200	0.303	0.310	MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans OX=6239 GN=mog-5 PE=1 SV=1
19	Q10752	664	1055	0.261	0.303	CDC28_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein cdc28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc28 PE=3 SV=2
20	Q14562	767	1220	0.319	0.321	DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens OX=9606 GN=DHX8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13245 AAA_19	4.5	18.9	AAA domain
2	PF13401 AAA_22	0.045	25.5	AAA domain
3	PF13604 AAA_30	3.4	18.9	AAA domain
4	PF13671 AAA_33	4.7e+02	12.4	AAA domain
5	PF12775 AAA_7	3.5e+02	12.1	P-loop containing dynein motor region
6	PF00270 DEAD	0.00062	31.1	DEAD/DEAH box helicase
7	PF07652 Flavi_DEAD	1.3e+02	14.0	Flavivirus DEAD domain
8	PF04408 HA2	1.9e-15	68.4	Helicase associated domain (HA2)
9	PF00271 Helicase_C	4e-10	51.4	Helicase conserved C-terminal domain
10	PF16796 Microtub_bd	2e+02	13.3	Microtubule binding
11	PF07717 OB_NTP_bind	1.1e-12	59.5	Oligonucleotide/oligosaccharide-binding (OB)-fold
12	PF02562 PhoH	74	14.3	PhoH-like protein
13	PF00437 T2SSE	21	15.6	Type II/IV secretion system protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000268482

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000317123	0.999	U5 small nuclear ribonucleoprotein 200 kDa helicase
2	9606.ENSP00000357928	0.999	Pre-mRNA-processing factor 17
3	9606.ENSP00000360532	0.998	Cell division cycle 5-like protein
4	9606.ENSP00000297151	0.997	Pre-mRNA-splicing factor SLU7
5	9606.ENSP00000478070	0.997	CWC25 spliceosome associated protein homolog
6	9606.ENSP00000351137	0.996	Pre-mRNA-splicing factor SYF1
7	9606.ENSP00000392094	0.995	116 kDa U5 small nuclear ribonucleoprotein component
8	9606.ENSP00000460348	0.995	Pre-mRNA-processing-splicing factor 8
9	9606.ENSP00000227524	0.994	Pre-mRNA-processing factor 19
10	9606.ENSP00000261531	0.993	SNW domain-containing protein 1
11	9606.ENSP00000262962	0.991	Part of the spliceosome which catalyzes two sequential transesterification reactions, first the excision of the non-coding intron from pre-mRNA and then the ligation of the coding exons to form the mature mRNA . Plays a role in stabilizing the structure of the spliceosome catalytic core and docking of the branch helix into the active site, producing 5'-exon and lariat intron-3'- intermediates (By similarity). May protect cells from TP53-dependent apoptosis upon dsDNA break damage through association with PRP19-CD5L complex
12	9606.ENSP00000387006	0.991	Pre-mRNA-splicing factor CWC22 homolog
13	9606.ENSP00000199814	0.990	Pre-mRNA-splicing factor RBM22
14	9606.ENSP00000366557	0.990	Crooked neck-like protein 1
15	9606.ENSP00000236273	0.987	Pre-mRNA-splicing factor SYF2
16	9606.ENSP00000254193	0.987	U2 small nuclear ribonucleoprotein A
17	9606.ENSP00000310723	0.986	Probable ATP-dependent RNA helicase DDX23
18	9606.ENSP00000475615	0.984	Spliceosome-associated protein CWC15 homolog
19	9606.ENSP00000301740	0.981	Serine/arginine repetitive matrix protein 2
20	9606.ENSP00000367835	0.977	Pre-mRNA-splicing factor 18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0140657	0.916	ATP-dependent activity
GO:0003824	0.904	catalytic activity
GO:0008186	0.673	ATP-dependent activity, acting on RNA

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0008380	0.993	RNA splicing
GO:0006397	0.992	mRNA processing
GO:0000398	0.981	mRNA splicing, via spliceosome
GO:0065007	0.509	biological regulation
GO:0050789	0.442	regulation of biological process
GO:0050794	0.412	regulation of cellular process
GO:0019222	0.360	regulation of metabolic process
GO:0060255	0.349	regulation of macromolecule metabolic process
GO:0080090	0.319	regulation of primary metabolic process
GO:0051171	0.319	regulation of nitrogen compound metabolic process
GO:0031323	0.319	regulation of cellular metabolic process
GO:0010468	0.312	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005654	0.998	nucleoplasm
GO:1990904	0.989	ribonucleoprotein complex
GO:0016020	0.964	membrane
GO:0140513	0.945	nuclear protein-containing complex
GO:1902494	0.883	catalytic complex
GO:0005681	0.880	spliceosomal complex
GO:0071013	0.794	catalytic step 2 spliceosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]