StarFunc result for job id Q92621

User Input

>input (2012 residues)
MATPLAVNSAASLWGPYKDIWHKVGNALWRRQPEAVHLLDKILKKHKPDFISLFKNPPKN
VQQHEKVQKASTEGVAIQGQQGTRLLPEQLIKEAFILSDLFDIGELAAVELLLAGEHQQP
HFPGLTRGLVAVLLYWDGKRCIANSLKALIQSRRGKTWTLELSPELASMTTRFTDELMEQ
GLTYKVLTLVSQIDVNNEFEKLQRERGLGSEKHRKEVSDLIKECRQSLAESLFAWACQSP
LGKEDTLLLIGHLERVTVEANGSLDAVNLALLMALLYCFDISFIEQSTEERDDMIHQLPL
LTEKQYIATIHSRLQDSQLWKLPGLQATVRLAWALALRGISQLPDVTALAEFTEADEAMA
ELAIADNVFLFLMESVVVSEYFYQEEFYIRRVHNLITDFLALMPMKVKQLRNRADEDARM
IHMSMQMGNEPPISLRRDLEHLMLLIGELYKKNPFHLELALEYWCPTEPLQTPTIMGSYL
GVAHQRPPQRQVVLSKFVRQMGDLLPPTIYIPYLKMLQGLANGPQCAHYCFSLLKVNGSS
HVENIQGAGGSPVSWEHFFHSLMLYHEHLRKDLPSADSVQYRHLPSRGITQKEQDGLIAF
LQLTSTIITWSENARLALCEHPQWTPVVVILGLLQCSIPPVLKAELLKTLAAFGKSPEIA
ASLWQSLEYTQILQTVRIPSQRQAIGIEVELNEIESRCEEYPLTRAFCQLISTLVESSFP
SNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEVFYKLLRDYEPQL
EDFVDQFVELQGEEIIAYKPPGFSLMYHLLNESPMLELALSLLEEGVKQLDTYAPFPGKK
HLEKAVQHCLALLNLTLQKENLFMDLLRESQLALIVCPLEQLLQGINPRTKKADNVVNIA
RYLYHGNTNPELAFESAKILCCISCNSNIQIKLVGDFTHDQSISQKLMAGFVECLDCEDA
EEFVRLEEGSELEKKLVAIRHETRIHILNLLITSLECNPPNLALYLLGFELKKPVSTTNL
QDPGVLGCPRTCLHAILNILEKGTEGRTGPVAVRESPQLAELCYQVIYQLCACSDTSGPT
MRYLRTSQDFLFSQLQYLPFSNKEYEISMLNQMSWLMKTASIELRVTSLNRQRSHTQRLL
HLLLDDMPVKPYSDGEGGIEDENRSVSGFLHFDTATKVRRKILNILDSIDFSQEIPEPLQ
LDFFDRAQIEQVIANCEHKNLRGQTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEIS
TVLQYVVGRNKLLQCLHAKRHALESWRQLVEIILTACPQDLIQAEDRQLIIRDILQDVHD
KILDDEAAQELMPVVAGAVFTLTAHLSQAVLTEQKETSVLGPAEAHYAFMLDSCFTSPPP
EENPLVGFASIGDSSLYIILKKLLDFILKTGGGFQRVRTHLYGSLLYYLQIAQRPDEPDT
LEAAKKTMWERLTAPEDVFSKLQRENIAIIESYGAALMEVVCRDACDGHEIGRMLALALL
DRIVSVDKQQQWLLYLSNSGYLKVLVDSLVEDDRTLQSLLTPQPPLLKALYTYESKMAFL
TRVAKIQQGALELLRSGVIVRLAQCQVYDMRPETDPQSMFGMRDPPMFIPTPVDRYRQIL
LPALQLCQVILTSSMAQHLQAAGQVLQFLISHSDTIQAILRCQDVSAGSLQELALLTGII
SKAALPGILSELDVDVNEGSLMELQGHIGRFQRQCLGLLSRFGGSDRLRQFKFQDDNVEG
DKVSKKDEIELAMQQICANVMEYCQSLMLQSSPTFQHAVCLFTPSLSETVNRDGPRQDTQ
APVVPYWRLPGLGIIIYLLKQSANDFFSYYDSHRQSVSKLQNVEQLPPDEIKELCQSVMP
AGVDKISTAQKYVLARRRLVKVINNRAKLLSLCSFIIETCLFILWRHLEYYLLHCMPTDS
QDSLFASRTLFKSRRLQDSFASETNLDFRSGLAIVSQHDLDQLQADAINAFGESLQKKLL
DIEGLYSKVRSRYSFIQALVRRIRGLLRISRN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7r5jC0	0.984	0.984	0.000	2011	1.000	1.000	7r5jC0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
2	AFDB:Q92621	1.000	1.000	0.000	2012	1.000	1.000	Q92621.pdb.gz	NU205_HUMAN Nuclear pore complex protein Nup205 OS=Homo sapiens OX=9606 GN=NUP205 PE=1 SV=3
3	AFDB:Q8IQV9	0.838	0.808	1.927E-95	2090	0.291	0.280	Q8IQV9.pdb.gz	NU205_DROME Nuclear pore complex protein Nup205 OS=Drosophila melanogaster OX=7227 GN=Nup205 PE=2 SV=1
4	PDB:5ijnD	0.318	0.579	4.816E-59	1028	0.506	0.991	5ijnD.pdb.gz
5	AFDB:F4KBW6	0.723	0.786	1.675E-51	1838	0.196	0.214	F4KBW6.pdb.gz	NU205_ARATH Nuclear pore complex protein NUP205 OS=Arabidopsis thaliana OX=3702 GN=NUP205 PE=1 SV=1
6	AFDB:Q21436	0.616	0.717	6.916E-44	1696	0.152	0.180	Q21436.pdb.gz	Q21436_CAEEL Nuclear Pore complex Protein OS=Caenorhabditis elegans OX=6239 GN=npp-3 PE=1 SV=1
7	AFDB:G0S4T0	0.586	0.662	4.603E-37	1756	0.153	0.175	G0S4T0.pdb.gz	NU192_CHATD Nucleoporin NUP192 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=NUP192 PE=1 SV=1
8	AFDB:P78847	0.603	0.722	1.284E-35	1647	0.137	0.168	P78847.pdb.gz	NU186_SCHPO Nucleoporin nup186 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup186 PE=2 SV=2
9	AFDB:P47054	0.543	0.634	9.291E-30	1683	0.139	0.166	P47054.pdb.gz	NU192_YEAST Nucleoporin NUP192 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP192 PE=1 SV=1
10	PDB:7mvvA	0.491	0.611	1.578E-29	1542	0.141	0.184	7mvvA.pdb.gz	Architecture of the linker-scaffold in the nuclear pore.
11	PDB:7r5jB0	0.476	0.532	7.352E-29	1748	0.159	0.183	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	AFDB:Q5SRE5	0.483	0.540	1.313E-28	1749	0.154	0.177	Q5SRE5.pdb.gz	NU188_HUMAN Nucleoporin NUP188 OS=Homo sapiens OX=9606 GN=NUP188 PE=1 SV=1
13	AFDB:Q583W5	0.445	0.434	3.886E-26	2070	0.161	0.156	Q583W5.pdb.gz	Q583W5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2H8.1110 PE=3 SV=1
14	PDB:5hb4B	0.495	0.685	4.559E-25	1388	0.137	0.199	5hb4B.pdb.gz
15	PDB:7n85O	0.509	0.648	2.963E-19	1521	0.128	0.169	7n85O.pdb.gz
16	AFDB:Q9P7M8	0.463	0.566	2.679E-16	1564	0.110	0.141	Q9P7M8.pdb.gz	NU184_SCHPO Nucleoporin nup184 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup184 PE=4 SV=1
17	PDB:7wooF	0.480	0.576	7.689E-15	1622	0.140	0.173	7wooF.pdb.gz
18	PDB:7mvxA	0.399	0.465	1.195E-12	1645	0.119	0.146	7mvxA.pdb.gz
19	PDB:7wo9A	0.412	0.496	1.379E-12	1581	0.109	0.139	7wo9A.pdb.gz
20	PDB:5ijoJ	0.294	0.439	1.253E-10	1256	0.105	0.169	5ijoJ.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IQV9	0.0	805	2090	0.306	0.294	NU205_DROME Nuclear pore complex protein Nup205 OS=Drosophila melanogaster OX=7227 GN=Nup205 PE=2 SV=1
2	Q92621	0.0	4140	2012	1.000	1.000	NU205_HUMAN Nuclear pore complex protein Nup205 OS=Homo sapiens OX=9606 GN=NUP205 PE=1 SV=3
3	F4KBW6	1.59e-42	174	1838	0.175	0.192	NU205_ARATH Nuclear pore complex protein NUP205 OS=Arabidopsis thaliana OX=3702 GN=NUP205 PE=1 SV=1
4	Q21436	1.79e-25	118	1696	0.050	0.059	Q21436_CAEEL Nuclear Pore complex Protein OS=Caenorhabditis elegans OX=6239 GN=npp-3 PE=1 SV=1
5	P78847	2.95e-06	55.1	1647	0.027	0.033	NU186_SCHPO Nucleoporin nup186 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup186 PE=2 SV=2
6	G0S4T0	0.001	46.6	1756	0.041	0.047	NU192_CHATD Nucleoporin NUP192 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=NUP192 PE=1 SV=1
7	P47054	0.28	38.9	1683	0.021	0.026	NU192_YEAST Nucleoporin NUP192 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP192 PE=1 SV=1
8	O15438	3.0	35.4	1527	0.022	0.029	MRP3_HUMAN ATP-binding cassette sub-family C member 3 OS=Homo sapiens OX=9606 GN=ABCC3 PE=1 SV=3
9	Q9HUY3	5.3	33.9	279	0.012	0.090	Q9HUY3_PSEAE Arylamine N-acetyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA4827 PE=1 SV=1
10	P21643	5.6	34.3	406	0.027	0.133	T23O_RAT Tryptophan 2,3-dioxygenase OS=Rattus norvegicus OX=10116 GN=Tdo2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11894 Nup192	0	1301.3	Nuclear pore complex scaffold, nucleoporins 186/192/205

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000285968

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231498	0.999	Nuclear pore complex protein Nup155
2	9606.ENSP00000310668	0.999	Nuclear pore complex protein Nup93
3	9606.ENSP00000316032	0.997	Nuclear pore complex protein Nup98-Nup96
4	9606.ENSP00000361658	0.997	Nucleoporin NUP188 homolog
5	9606.ENSP00000471191	0.996	Nuclear pore glycoprotein p62
6	9606.ENSP00000229179	0.994	Nuclear pore complex protein Nup107
7	9606.ENSP00000264883	0.989	Nucleoporin p54
8	9606.ENSP00000308622	0.986	Nucleoporin GLE1
9	9606.ENSP00000371155	0.985	Nucleoporin p58/p45
10	9606.ENSP00000444029	0.985	Nuclear pore complex protein Nup153
11	9606.ENSP00000382779	0.984	Nucleoporin SEH1
12	9606.ENSP00000261396	0.983	Nuclear pore complex protein Nup133
13	9606.ENSP00000295119	0.983	Nucleoporin NUP53
14	9606.ENSP00000245544	0.979	Nuclear pore complex protein Nup85
15	9606.ENSP00000458954	0.976	Nuclear pore complex protein Nup88
16	9606.ENSP00000352400	0.975	Nuclear pore complex protein Nup214
17	9606.ENSP00000356448	0.972	Nucleoprotein TPR
18	9606.ENSP00000379182	0.971	mRNA export factor
19	9606.ENSP00000254508	0.970	Nuclear pore membrane glycoprotein 210
20	9606.ENSP00000367721	0.964	Nuclear pore complex protein Nup160

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017056	1.000	structural constituent of nuclear pore
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0016043	0.986	cellular component organization
GO:0043933	0.984	protein-containing complex organization
GO:0006996	0.978	organelle organization
GO:0022607	0.978	cellular component assembly
GO:0065003	0.957	protein-containing complex assembly
GO:0006997	0.955	nucleus organization
GO:0051169	0.927	nuclear transport
GO:0006913	0.921	nucleocytoplasmic transport
GO:0006999	0.906	nuclear pore organization
GO:0046931	0.888	pore complex assembly
GO:0065007	0.336	biological regulation
GO:0050794	0.334	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0031965	0.999	nuclear membrane
GO:0005643	0.999	nuclear pore
GO:0034399	0.998	nuclear periphery
GO:0005654	0.961	nucleoplasm
GO:0043228	0.566	non-membrane-bounded organelle
GO:0043232	0.560	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]