StarFunc result for job id Q92622

User Input

>input (972 residues)
MRPEGAGMELGGGEERLPEESRREHWQLLGNLKTTVEGLVSTNSPNVWSKYGGLERLCRD
MQSILYHGLIRDQACRRQTDYWQFVKDIRWLSPHSALHVEKFISVHENDQSSADGASERA
VAELWLQHSLQYHCLSAQLRPLLGDRQYIRKFYTDAAFLLSDAHVTAMLQCLEAVEQNNP
RLLAQIDASMFARKHESPLLVTKSQSLTALPSSTYTPPNSYAQHSYFGSFSSLHQSVPNN
GSERRSTSFPLSGPPRKPQESRGHVSPAEDQTIQAPPVSVSALARDSPLTPNEMSSSTLT
SPIEASWVSSQNDSPGDASEGPEYLAIGNLDPRGRTASCQSHSSNAESSSSNLFSSSSSQ
KPDSAASSLGDQEGGGESQLSSVLRRSSFSEGQTLTVTSGAKKSHIRSHSDTSIASRGAP
ESCNDKAKLRGPLPYSGQSSEVSTPSSLYMEYEGGRYLCSGEGMFRRPSEGQSLISYLSE
QDFGSCADLEKENAHFSISESLIAAIELMKCNMMSQCLEEEEVEEEDSDREIQELKQKIR
LRRQQIRTKNLLPMYQEAEHGSFRVTSSSSQFSSRDSAQLSDSGSADEVDEFEIQDADIR
RNTASSSKSFVSSQSFSHCFLHSTSAEAVAMGLLKQFEGMQLPAASELEWLVPEHDAPQK
LLPIPDSLPISPDDGQHADIYKLRIRVRGNLEWAPPRPQIIFNVHPAPTRKIAVAKQNYR
CAGCGIRTDPDYIKRLRYCEYLGKYFCQCCHENAQMAIPSRVLRKWDFSKYYVSNFSKDL
LIKIWNDPLFNVQDINSALYRKVKLLNQVRLLRVQLCHMKNMFKTCRLAKELLDSFDTVP
GHLTEDLHLYSLNDLTATRKGELGPRLAELTRAGATHVERCMLCQAKGFICEFCQNEDDI
IFPFELHKCRTCEECKACYHKACFKSGSCPRCERLQARREALARQSLESYLSDYEEEPAE
ALALEAAVLEAT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92622	1.000	1.000	0.000	972	1.000	1.000	Q92622.pdb.gz	RUBIC_HUMAN Run domain Beclin-1-interacting and cysteine-rich domain-containing protein OS=Homo sapiens OX=9606 GN=RUBCN PE=1 SV=4
2	AFDB:Q80U62	0.438	0.443	1.552E-102	956	0.856	0.870	Q80U62.pdb.gz	RUBIC_MOUSE Run domain Beclin-1-interacting and cysteine-rich domain-containing protein OS=Mus musculus OX=10090 GN=Rubcn PE=1 SV=2
3	AFDB:A0A0R4IL48	0.058	0.061	1.363E-1	876	0.123	0.137	A0A0R4IL48.pdb.gz
4	AFDB:Q9VHC4	0.045	0.040	1.799E-1	1133	0.107	0.092	Q9VHC4.pdb.gz	Q9VHC4_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=FCHo2 PE=1 SV=3
5	AFDB:A2A8R0	0.060	0.042	2.374E-1	1397	0.103	0.072	A2A8R0.pdb.gz	A2A8R0_MOUSE Zinc finger FYVE domain-containing protein OS=Mus musculus OX=10090 GN=Zfyve9 PE=1 SV=1
6	AFDB:Q9VA38	0.048	0.044	2.486E-1	1105	0.092	0.081	Q9VA38.pdb.gz	WARTS_DROME Serine/threonine-protein kinase Warts OS=Drosophila melanogaster OX=7227 GN=wts PE=1 SV=1
7	AFDB:P49418	0.053	0.068	2.856E-1	695	0.084	0.118	P49418.pdb.gz	AMPH_HUMAN Amphiphysin OS=Homo sapiens OX=9606 GN=AMPH PE=1 SV=1
8	AFDB:P09603	0.051	0.073	3.132E-1	554	0.095	0.166	P09603.pdb.gz	CSF1_HUMAN Macrophage colony-stimulating factor 1 OS=Homo sapiens OX=9606 GN=CSF1 PE=1 SV=2
9	AFDB:Q9VMA7	0.054	0.040	3.132E-1	1430	0.132	0.090	Q9VMA7.pdb.gz	TGO1_DROME Transport and Golgi organization protein 1 OS=Drosophila melanogaster OX=7227 GN=Tango1 PE=1 SV=2
10	AFDB:R4GLV5	0.051	0.046	3.946E-1	1116	0.087	0.076	R4GLV5.pdb.gz
11	PDB:3c98B	0.049	0.176	4.608E-1	230	0.020	0.083	3c98B.pdb.gz
12	PDB:7yqcA	0.045	0.145	5.054E-1	198	0.025	0.121	7yqcA.pdb.gz
13	PDB:1rhgB	0.048	0.214	5.806E-1	144	0.023	0.153	1rhgB.pdb.gz
14	PDB:6xz6A	0.043	0.142	1.059	213	0.022	0.099	6xz6A.pdb.gz
15	PDB:7zxkC	0.049	0.155	1.161	166	0.031	0.181	7zxkC.pdb.gz
16	PDB:6n63A	0.049	0.227	1.274	141	0.026	0.177	6n63A.pdb.gz	Large protein organelles form a new iron sequestration system with high storage capacity.
17	PDB:3vprA	0.054	0.173	1.334	189	0.028	0.143	3vprA.pdb.gz
18	PDB:1bp3A	0.050	0.165	1.532	186	0.032	0.167	1bp3A.pdb.gz	The X-ray structure of a growth hormone-prolactin receptor complex.
19	PDB:6swy8	0.066	0.128	1.605	325	0.035	0.105	6swy8.pdb.gz
20	PDB:7nsuD	0.037	0.072	1.605	420	0.019	0.043	7nsuD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0Y6E6	0.0	1884	934	0.947	0.985	H0Y6E6_HUMAN Rubicon autophagy regulator (Fragment) OS=Homo sapiens OX=9606 GN=RUBCN PE=1 SV=1
2	Q80U62	0.0	1606	956	0.856	0.870	RUBIC_MOUSE Run domain Beclin-1-interacting and cysteine-rich domain-containing protein OS=Mus musculus OX=10090 GN=Rubcn PE=1 SV=2
3	Q92622	0.0	2013	972	1.000	1.000	RUBIC_HUMAN Run domain Beclin-1-interacting and cysteine-rich domain-containing protein OS=Homo sapiens OX=9606 GN=RUBCN PE=1 SV=4
4	Q9H714	2.73e-105	344	662	0.193	0.284	PACER_HUMAN Protein associated with UVRAG as autophagy enhancer OS=Homo sapiens OX=9606 GN=RUBCNL PE=1 SV=3
5	Q3TD16	1.77e-81	279	648	0.138	0.207	PACER_MOUSE Protein associated with UVRAG as autophagy enhancer OS=Mus musculus OX=10090 GN=Rubcnl PE=1 SV=2
6	Q6ZN54	1.66e-37	150	512	0.093	0.176	DEFI8_HUMAN Differentially expressed in FDCP 8 homolog OS=Homo sapiens OX=9606 GN=DEF8 PE=1 SV=2
7	Q8BM47	3.93e-37	152	761	0.090	0.114	PKHM3_MOUSE Pleckstrin homology domain-containing family M member 3 OS=Mus musculus OX=10090 GN=Plekhm3 PE=1 SV=1
8	Q99J78	2.62e-36	145	448	0.091	0.196	DEFI8_MOUSE Differentially expressed in FDCP 8 OS=Mus musculus OX=10090 GN=Def8 PE=1 SV=1
9	Q9Y4G2	1.43e-31	135	1056	0.079	0.073	PKHM1_HUMAN Pleckstrin homology domain-containing family M member 1 OS=Homo sapiens OX=9606 GN=PLEKHM1 PE=1 SV=3
10	Q7TSI1	9.27e-31	133	1074	0.079	0.072	PKHM1_MOUSE Pleckstrin homology domain-containing family M member 1 OS=Mus musculus OX=10090 GN=Plekhm1 PE=1 SV=1
11	K8ESM7	1.46e-26	119	955	0.071	0.072	K8ESM7_CAEEL RUN domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cup-14 PE=1 SV=1
12	Q38BR7	3.49e-11	69.3	541	0.056	0.100	Q38BR7_TRYB2 Rubicon Homology domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4140 PE=4 SV=1
13	P0ADE4	0.45	36.6	577	0.030	0.050	TAMA_ECOLI Translocation and assembly module subunit TamA OS=Escherichia coli (strain K12) OX=83333 GN=tamA PE=1 SV=1
14	Q383B7	1.1	35.0	242	0.020	0.079	Q383B7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3500 PE=1 SV=1
15	Q1LYP4	3.5	33.9	1929	0.019	0.009	Q1LYP4_DANRE DNA helicase OS=Danio rerio OX=7955 GN=im:7143343 PE=1 SV=1
16	Q5FVJ0	4.0	33.5	469	0.036	0.075	RUFY3_RAT Protein RUFY3 OS=Rattus norvegicus OX=10116 GN=Rufy3 PE=1 SV=1
17	Q7L099	4.0	33.5	469	0.036	0.075	RUFY3_HUMAN Protein RUFY3 OS=Homo sapiens OX=9606 GN=RUFY3 PE=1 SV=1
18	Q9D394	5.0	33.1	469	0.036	0.075	RUFY3_MOUSE Protein RUFY3 OS=Mus musculus OX=10090 GN=Rufy3 PE=1 SV=1
19	Q9SCX8	5.9	32.7	338	0.020	0.056	PPA17_ARATH Purple acid phosphatase 17 OS=Arabidopsis thaliana OX=3702 GN=PAP17 PE=2 SV=1
20	P0AC65	6.5	30.4	81	0.013	0.160	NRDH_ECOLI Glutaredoxin-like protein NrdH OS=Escherichia coli (strain K12) OX=83333 GN=nrdH PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02759 RUN	2.3e-05	35.9	RUN domain
2	PF13901 zf-RING_9	3.7e-66	234.5	Putative zinc-RING and/or ribbon

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296343

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348455	0.999	UV radiation resistance-associated gene protein
2	9606.ENSP00000355231	0.998	Beclin-1
3	9606.ENSP00000262039	0.988	Phosphatidylinositol 3-kinase catalytic subunit type 3
4	9606.ENSP00000349205	0.941	Phosphoinositide 3-kinase regulatory subunit 4
5	9606.ENSP00000265062	0.931	Ras-related protein Rab-7a
6	9606.ENSP00000483825	0.898	NF-kappa-B essential modulator
7	9606.ENSP00000261623	0.894	Cytochrome b-245 light chain
8	9606.ENSP00000247178	0.893	Beclin 1-associated autophagy-related key regulator
9	9606.ENSP00000275493	0.817	Epidermal growth factor receptor
10	9606.ENSP00000360797	0.718	Caspase recruitment domain-containing protein 9
11	9606.ENSP00000431926	0.701	Activating molecule in BECN1-regulated autophagy protein 1
12	9606.ENSP00000283195	0.688	E3 SUMO-protein ligase RanBP2
13	9606.ENSP00000334375	0.687	Leucine rich repeats and calponin homology domain containing 3
14	9606.ENSP00000479919	0.659	Endophilin-B1
15	9606.ENSP00000361930	0.658	14-3-3 protein beta/alpha
16	9606.ENSP00000479762	0.645	Ras-related protein Rab-7b
17	9606.ENSP00000282020	0.616	Glutamate receptor ionotropic, delta-2
18	9606.ENSP00000355605	0.599	Exocyst complex component 8
19	9606.ENSP00000471896	0.599	Interferon regulatory factor 3
20	9606.ENSP00000304376	0.597	Ras-related protein Rab-24

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0010506	0.985	regulation of autophagy
GO:0065009	0.984	regulation of molecular function
GO:0043549	0.968	regulation of kinase activity
GO:0016192	0.955	vesicle-mediated transport
GO:0051128	0.953	regulation of cellular component organization
GO:0080090	0.950	regulation of primary metabolic process
GO:0048519	0.937	negative regulation of biological process
GO:0032879	0.932	regulation of localization
GO:0009895	0.928	negative regulation of catabolic process
GO:0048523	0.925	negative regulation of cellular process
GO:0016241	0.924	regulation of macroautophagy
GO:0019216	0.914	regulation of lipid metabolic process
GO:0051049	0.913	regulation of transport
GO:0043244	0.905	regulation of protein-containing complex disassembly
GO:0043550	0.882	regulation of lipid kinase activity
GO:0031324	0.847	negative regulation of cellular metabolic process
GO:0051129	0.834	negative regulation of cellular component organization
GO:0043551	0.824	regulation of phosphatidylinositol 3-kinase activity
GO:0009987	0.809	cellular process
GO:0010563	0.802	negative regulation of phosphorus metabolic process
GO:0045936	0.782	negative regulation of phosphate metabolic process
GO:0043086	0.777	negative regulation of catalytic activity
GO:0051348	0.773	negative regulation of transferase activity
GO:0031330	0.766	negative regulation of cellular catabolic process
GO:0010507	0.724	negative regulation of autophagy
GO:0045833	0.711	negative regulation of lipid metabolic process
GO:0033673	0.613	negative regulation of kinase activity
GO:0043242	0.543	negative regulation of protein-containing complex disassembly
GO:0033043	0.508	regulation of organelle organization
GO:0071840	0.459	cellular component organization or biogenesis
GO:0008152	0.448	metabolic process
GO:0048518	0.438	positive regulation of biological process
GO:0060627	0.432	regulation of vesicle-mediated transport
GO:0016043	0.414	cellular component organization
GO:0048522	0.390	positive regulation of cellular process
GO:0051051	0.360	negative regulation of transport
GO:0071985	0.359	multivesicular body sorting pathway
GO:0045806	0.352	negative regulation of endocytosis
GO:0044237	0.347	cellular metabolic process
GO:0051171	0.347	regulation of nitrogen compound metabolic process
GO:0051641	0.340	cellular localization
GO:0016242	0.328	negative regulation of macroautophagy
GO:0050896	0.324	response to stimulus
GO:0060255	0.324	regulation of macromolecule metabolic process
GO:0071704	0.320	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.999	nucleoplasm
GO:0012505	0.982	endomembrane system
GO:0031982	0.899	vesicle
GO:0005768	0.849	endosome
GO:0016020	0.839	membrane
GO:0031090	0.761	organelle membrane
GO:0005770	0.725	late endosome
GO:0005769	0.633	early endosome
GO:0032991	0.585	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]