StarFunc result for job id Q92626

User Input

>input (1479 residues)
MAKRSRGPGRRCLLALVLFCAWGTLAVVAQKPGAGCPSRCLCFRTTVRCMHLLLEAVPAV
APQTSILDLRFNRIREIQPGAFRRLRNLNTLLLNNNQIKRIPSGAFEDLENLKYLYLYKN
EIQSIDRQAFKGLASLEQLYLHFNQIETLDPDSFQHLPKLERLFLHNNRITHLVPGTFNH
LESMKRLRLDSNTLHCDCEILWLADLLKTYAESGNAQAAAICEYPRRIQGRSVATITPEE
LNCERPRITSEPQDADVTSGNTVYFTCRAEGNPKPEIIWLRNNNELSMKTDSRLNLLDDG
TLMIQNTQETDQGIYQCMAKNVAGEVKTQEVTLRYFGSPARPTFVIQPQNTEVLVGESVT
LECSATGHPPPRISWTRGDRTPLPVDPRVNITPSGGLYIQNVVQGDSGEYACSATNNIDS
VHATAFIIVQALPQFTVTPQDRVVIEGQTVDFQCEAKGNPPPVIAWTKGGSQLSVDRRHL
VLSSGTLRISGVALHDQGQYECQAVNIIGSQKVVAHLTVQPRVTPVFASIPSDTTVEVGA
NVQLPCSSQGEPEPAITWNKDGVQVTESGKFHISPEGFLTINDVGPADAGRYECVARNTI
GSASVSMVLSVNVPDVSRNGDPFVATSIVEAIATVDRAINSTRTHLFDSRPRSPNDLLAL
FRYPRDPYTVEQARAGEIFERTLQLIQEHVQHGLMVDLNGTSYHYNDLVSPQYLNLIANL
SGCTAHRRVNNCSDMCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKSVYENGFNTPRG
INPHRLYNGHALPMPRLVSTTLIGTETVTPDEQFTHMLMQWGQFLDHDLDSTVVALSQAR
FSDGQHCSNVCSNDPPCFSVMIPPNDSRARSGARCMFFVRSSPVCGSGMTSLLMNSVYPR
EQINQLTSYIDASNVYGSTEHEARSIRDLASHRGLLRQGIVQRSGKPLLPFATGPPTECM
RDENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIATELLKLNPHWDGDTIYYETRK
IVGAEIQHITYQHWLPKILGEVGMRTLGEYHGYDPGINAGIFNAFATAAFRFGHTLVNPL
LYRLDENFQPIAQDHLPLHKAFFSPFRIVNEGGIDPLLRGLFGVAGKMRVPSQLLNTELT
ERLFSMAHTVALDLAAINIQRGRDHGIPPYHDYRVYCNLSAAHTFEDLKNEIKNPEIREK
LKRLYGSTLNIDLFPALVVEDLVPGSRLGPTLMCLLSTQFKRLRDGDRLWYENPGVFSPA
QLTQIKQTSLARILCDNADNITRVQSDVFRVAEFPHGYGSCDEIPRVDLRVWQDCCEDCR
TRGQFNAFSYHFRGRRSLEFSYQEDKPTKKTRPRKIPSVGRQGEHLSNSTSAFSTRSDAS
GTNDFREFVLEMQKTITDLRTQIKKLESRLSTTECVDAGGESHANNTKWKKDACTICECK
DGQVTCFVEACPPATCAVPVNIPGACCPVCLQKRAEEKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2KHM6	0.475	0.481	0.000	1460	0.740	0.750	A0A0G2KHM6.pdb.gz
2	AFDB:G5EG78	0.472	0.524	0.000	1328	0.334	0.372	G5EG78.pdb.gz	PXDN2_CAEEL Peroxidasin homolog pxn-2 OS=Caenorhabditis elegans OX=6239 GN=pxn-2 PE=1 SV=1
3	AFDB:Q1ENI8	0.450	0.516	0.000	1285	0.335	0.386	Q1ENI8.pdb.gz	PXDN1_CAEEL Peroxidasin homolog pxn-1 OS=Caenorhabditis elegans OX=6239 GN=pxn-1 PE=1 SV=1
4	AFDB:Q92626	1.000	1.000	0.000	1479	1.000	1.000	Q92626.pdb.gz	PXDN_HUMAN Peroxidasin homolog OS=Homo sapiens OX=9606 GN=PXDN PE=1 SV=2
5	AFDB:Q9VZZ4	0.460	0.446	0.000	1527	0.421	0.407	Q9VZZ4.pdb.gz	PXDN_DROME Peroxidasin OS=Drosophila melanogaster OX=7227 GN=Pxn PE=1 SV=1
6	AFDB:F1R9R1	0.454	0.745	3.042E-75	893	0.206	0.340	F1R9R1.pdb.gz
7	AFDB:C9DTM6	0.454	0.861	2.198E-74	771	0.195	0.374	C9DTM6.pdb.gz	C9DTM6_ICTPU Eosinophil peroxidase precursor OS=Ictalurus punctatus OX=7998 GN=mpx PE=2 SV=1
8	AFDB:P14650	0.447	0.717	4.050E-73	914	0.200	0.324	P14650.pdb.gz	PERT_RAT Thyroid peroxidase OS=Rattus norvegicus OX=10116 GN=Tpo PE=2 SV=1
9	AFDB:P09933	0.453	0.717	3.246E-72	926	0.202	0.323	P09933.pdb.gz	PERT_PIG Thyroid peroxidase OS=Sus scrofa OX=9823 GN=TPO PE=1 SV=1
10	AFDB:P07202	0.454	0.711	1.074E-71	933	0.199	0.316	P07202.pdb.gz	PERT_HUMAN Thyroid peroxidase OS=Homo sapiens OX=9606 GN=TPO PE=1 SV=4
11	PDB:5mfaA	0.377	0.936	8.762E-60	588	0.172	0.434	5mfaA.pdb.gz	Structure of human promyeloperoxidase (proMPO) and the role of the propeptide in processing and maturation.
12	PDB:4hhrA	0.306	0.675	3.004E-22	640	0.082	0.189	4hhrA.pdb.gz	The crystal structure of alpha-Dioxygenase provides insight into diversity in the cyclooxygenase-peroxidase superfamily.
13	PDB:5oj2B	0.097	0.173	8.393E-21	692	0.064	0.137	5oj2B.pdb.gz
14	PDB:6dldD	0.121	0.512	6.903E-18	269	0.048	0.264	6dldD.pdb.gz
15	PDB:5f1aA	0.249	0.636	1.047E-17	553	0.062	0.165	5f1aA.pdb.gz	Crystal Structure of Aspirin-Acetylated Human Cyclooxygenase-2: Insight into the Formation of Products with Reversed Stereochemistry.
16	PDB:1e07A	0.108	0.202	1.761E-17	642	0.048	0.111	1e07A.pdb.gz
17	PDB:4rs0A	0.246	0.617	2.059E-17	557	0.061	0.162	4rs0A.pdb.gz	Action at a Distance: MUTATIONS OF PERIPHERAL RESIDUES TRANSFORM RAPID REVERSIBLE INHIBITORS TO SLOW, TIGHT BINDERS OF CYCLOOXYGENASE-2.
18	PDB:5y31B	0.123	0.312	4.672E-16	511	0.064	0.184	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
19	PDB:6y3cA	0.252	0.630	5.753E-16	557	0.059	0.156	6y3cA.pdb.gz
20	PDB:6dlfA	0.120	0.614	1.716E-15	236	0.046	0.288	6dlfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G5EG78	0.0	784	1328	0.267	0.297	PXDN2_CAEEL Peroxidasin homolog pxn-2 OS=Caenorhabditis elegans OX=6239 GN=pxn-2 PE=1 SV=1
2	Q1ENI8	0.0	813	1285	0.275	0.317	PXDN1_CAEEL Peroxidasin homolog pxn-1 OS=Caenorhabditis elegans OX=6239 GN=pxn-1 PE=1 SV=1
3	Q3UQ28	0.0	2784	1475	0.908	0.911	PXDN_MOUSE Peroxidasin homolog OS=Mus musculus OX=10090 GN=Pxdn PE=1 SV=2
4	Q92626	0.0	3082	1479	1.000	1.000	PXDN_HUMAN Peroxidasin homolog OS=Homo sapiens OX=9606 GN=PXDN PE=1 SV=2
5	Q9VZZ4	0.0	1155	1527	0.428	0.415	PXDN_DROME Peroxidasin OS=Drosophila melanogaster OX=7227 GN=Pxn PE=1 SV=1
6	P09933	2.67e-180	563	926	0.206	0.328	PERT_PIG Thyroid peroxidase OS=Sus scrofa OX=9823 GN=TPO PE=1 SV=1
7	P14650	1.78e-176	553	914	0.205	0.332	PERT_RAT Thyroid peroxidase OS=Rattus norvegicus OX=10116 GN=Tpo PE=2 SV=1
8	P35419	3.24e-174	547	914	0.201	0.326	PERT_MOUSE Thyroid peroxidase OS=Mus musculus OX=10090 GN=Tpo PE=2 SV=1
9	F1Q944	9.64e-174	540	762	0.204	0.396	F1Q944_DANRE Eosinophil peroxidase isoform 2 precursor OS=Danio rerio OX=7955 GN=drf PE=1 SV=1
10	Q90XS6	4.00e-172	536	762	0.202	0.392	Q90XS6_DANRE Myeloperoxidase OS=Danio rerio OX=7955 GN=mpx PE=2 SV=1
11	P07202	5.50e-170	536	933	0.206	0.327	PERT_HUMAN Thyroid peroxidase OS=Homo sapiens OX=9606 GN=TPO PE=1 SV=4
12	P11678	1.20e-169	528	715	0.195	0.404	PERE_HUMAN Eosinophil peroxidase OS=Homo sapiens OX=9606 GN=EPX PE=1 SV=2
13	C9DTM6	1.65e-168	527	771	0.195	0.375	C9DTM6_ICTPU Eosinophil peroxidase precursor OS=Ictalurus punctatus OX=7998 GN=mpx PE=2 SV=1
14	P49290	2.91e-166	519	716	0.192	0.397	PERE_MOUSE Eosinophil peroxidase OS=Mus musculus OX=10090 GN=Epx PE=1 SV=2
15	P05164	8.97e-164	513	745	0.194	0.385	PERM_HUMAN Myeloperoxidase OS=Homo sapiens OX=9606 GN=MPO PE=1 SV=1
16	P11247	3.26e-163	511	718	0.189	0.390	PERM_MOUSE Myeloperoxidase OS=Mus musculus OX=10090 GN=Mpo PE=1 SV=2
17	A0A0G2K1A2	1.15e-158	499	719	0.191	0.392	A0A0G2K1A2_RAT Myeloperoxidase OS=Rattus norvegicus OX=10116 GN=Mpo PE=1 SV=2
18	Q5SW46	1.89e-146	466	710	0.180	0.375	PERL_MOUSE Lactoperoxidase OS=Mus musculus OX=10090 GN=Lpo PE=1 SV=1
19	P22079	1.14e-145	464	712	0.181	0.376	PERL_HUMAN Lactoperoxidase OS=Homo sapiens OX=9606 GN=LPO PE=1 SV=2
20	Q8R481	2.07e-145	463	710	0.183	0.380	PERL_MESAU Lactoperoxidase OS=Mesocricetus auratus OX=10036 GN=LPO PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03098 An_peroxidase	3.6e-186	631.5	Animal haem peroxidase
2	PF01453 B_lectin	4.4e+02	12.7	D-mannose binding lectin
3	PF07654 C1-set	2.1e+02	13.7	Immunoglobulin C1-set domain
4	PF08205 C2-set_2	1.2e-15	68.7	CD80-like C2-set immunoglobulin domain
5	PF07679 I-set	6.7e-84	287.4	Immunoglobulin I-set domain
6	PF00047 ig	1.5e-36	135.8	Immunoglobulin domain
7	PF13895 Ig_2	3.2e-48	173.3	Immunoglobulin domain
8	PF13927 Ig_3	5.7e-70	243.2	Immunoglobulin domain
9	PF16680 Ig_4	9.4e-05	34.3	T-cell surface glycoprotein CD3 delta chain
10	PF16681 Ig_5	3.6e-11	54.7	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
11	PF17736 Ig_C17orf99	0.0005	31.4	C17orf99 Ig domain
12	PF16706 Izumo-Ig	5.7	18.3	Izumo-like Immunoglobulin domain
13	PF01463 LRRCT	95	15.0	Leucine rich repeat C-terminal domain
14	PF00560 LRR_1	0.81	21.2	Leucine Rich Repeat
15	PF12799 LRR_4	4.8e-11	53.9	Leucine Rich repeats (2 copies)
16	PF13306 LRR_5	1.9e-07	42.5	BspA type Leucine rich repeat region (6 copies)
17	PF13855 LRR_8	2.2e-36	134.7	Leucine rich repeat
18	PF14580 LRR_9	1.8e-08	45.6	Leucine-rich repeat
19	PF05825 PSP94	0.062	25.2	Beta-microseminoprotein (PSP-94)
20	PF07686 V-set	2.2e-18	77.8	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252804

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000323065	0.764	Growth arrest and DNA damage-inducible proteins-interacting protein 1
2	9606.ENSP00000396103	0.715	Myelin transcription factor 1-like protein
3	9606.ENSP00000423067	0.686	WD repeat-containing protein 36
4	9606.ENSP00000311837	0.660	Gamma-2-syntrophin
5	9606.ENSP00000434847	0.637	Tsukushin
6	9606.ENSP00000037502	0.635	Myocilin
7	9606.ENSP00000469455	0.634	Neurotrophin-4
8	9606.ENSP00000364979	0.631	Collagen alpha-1(IV) chain
9	9606.ENSP00000368022	0.630	Optineurin
10	9606.ENSP00000360882	0.626	Collagen alpha-1(V) chain
11	9606.ENSP00000478561	0.582	Cytochrome P450 1B1
12	9606.ENSP00000364000	0.573	Collagen alpha-2(V) chain
13	9606.ENSP00000353654	0.567	Collagen alpha-2(IV) chain
14	9606.ENSP00000325527	0.547	Fibrillin-1
15	9606.ENSP00000296575	0.518	Hedgehog-interacting protein
16	9606.ENSP00000342026	0.507	Peroxiredoxin-6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0016684	0.997	oxidoreductase activity, acting on peroxide as acceptor
GO:0004601	0.976	peroxidase activity
GO:0005201	0.886	extracellular matrix structural constituent
GO:0020037	0.866	heme binding
GO:0050840	0.823	extracellular matrix binding
GO:0043236	0.806	laminin binding
GO:0043237	0.396	laminin-1 binding
GO:0042802	0.395	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0016043	0.970	cellular component organization
GO:0045229	0.961	external encapsulating structure organization
GO:0032501	0.927	multicellular organismal process
GO:0030198	0.904	extracellular matrix organization
GO:0032502	0.882	developmental process
GO:0048856	0.859	anatomical structure development
GO:0007275	0.837	multicellular organism development
GO:0071711	0.791	basement membrane organization
GO:0022607	0.714	cellular component assembly
GO:0048731	0.690	system development
GO:0085029	0.656	extracellular matrix assembly
GO:0065007	0.538	biological regulation
GO:0050789	0.493	regulation of biological process
GO:0050794	0.426	regulation of cellular process
GO:0008152	0.349	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	0.996	collagen-containing extracellular matrix
GO:0005615	0.995	extracellular space
GO:0043226	0.985	organelle
GO:0043227	0.975	membrane-bounded organelle
GO:0043233	0.967	organelle lumen
GO:0070013	0.962	intracellular organelle lumen
GO:0005737	0.934	cytoplasm
GO:0012505	0.868	endomembrane system
GO:0043231	0.837	intracellular membrane-bounded organelle
GO:0031982	0.716	vesicle
GO:0043230	0.565	extracellular organelle
GO:1903561	0.545	extracellular vesicle
GO:0070062	0.519	extracellular exosome
GO:0016020	0.492	membrane
GO:0005886	0.447	plasma membrane
GO:0005783	0.431	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.11.-.-	0.997	Acting on a peroxide as acceptor.
EC:1.11.1.-	0.976	Peroxidases.

[back to server]