StarFunc result for job id Q92628

User Input

>input (1395 residues)
MYPICTVVVDGLPSESSSSSYPGPVSVSEMSLLHALGPVQTWLGQELEKCGIDAMIYTRY
VLSLLLHDSYDYDLQEQENDIFLGWEKGAYKKWGKSKKKCSDLTLEEMKKQAAVQCLRSA
SDESSGIETLVEELCSRLKDLQSKQEEKIHKKLEGSPSPEAELSPPAKDQVEMYYEAFPP
LSEKPVCLQEIMTVWNKSKVCSYSSSSSSSTAPPASTDTSSPKDCNSESEVTKERSSEVP
TTVHEKTQSKSKNEKENKFSNGTIEEKPALYKKQIRHKPEGKIRPRSWSSGSSEAGSSSS
GNQGELKASMKYVKVRHKAREIRNKKGRNGQSRLSLKHGEKAERNIHTGSSSSSSSGSVK
QLCKRGKRPLKEIGRKDPGSTEGKDLYMENRKDTEYKEEPLWYTEPIAEYFVPLSRKSKL
ETTYRNRQDTSDLTSEAVEELSESVHGLCISNNNLHKTYLAAGTFIDGHFVEMPAVINED
IDLTGTSLCSLPEDNKYLDDIHLSELTHFYEVDIDQSMLDPGASETMQGESRILNMIRQK
SKENTDFEAECCIVLDGMELQGERAIWTDSTSSVGAEGLFLQDLGNLAQFWECCSSSSGD
ADGESFGGDSPVRLSPILDSTVLNSHLLAGNQELFSDINEGSGINSCFSVFEVQCSNSVL
PFSFETLNLGNENTDSSANMLGKTQSRLLIWTKNSAFEENEHCSNLSTRTCSPWSHSEET
RSDNETLNIQFEESTQFNAEDINYVVPRVSSNYVDEELLDFLQDETCQQNSRTLGEIPTL
VFKKTSKLESVCGIQLEQKTENKNFETTQVCNESPHGDGYSSGVIKDIWTKMADTNSVAT
VEIERTDAELFSADVNNYCCCLDAEAELETLQEPDKAVRRSEYHLWEGQKESLEKRAFAS
SELSNVDGGDYTTPSKPWDVAQDKENTFILGGVYGELKTFNSDGEWAVVPPSHTKGSLLQ
CAASDVVTIAGTDVFMTPGNSFAPGHRQLWKPFVSFEQNDQPKSGENGLNKGFSFIFHED
LLGACGNFQVEDPGLEYSFSSFDLSNPFSQVLHVECSFEPEGIASFSPSFKPKSILCSDS
DSEVFHPRICGVDRTQYRAIRISPRTHFRPISASELSPGGGSESEFESEKDEANIPIPSQ
VDIFEDPQADLKPLEEDAEKEGHYYGKSELESGKFLPRLKKSGMEKSAQTSLDSQEESTG
ILSVGKQNQCLECSMNESLEIDLESSEANCKIMAQCEEEINNFCGCKAGCQFPAYEDNPV
SSGQLEEFPVLNTDIQGMNRSQEKQTWWEKALYSPLFPASECEECYTNAKGESGLEEYPD
AKETPSNEERLLDFNRVSSVYEARCTGERDSGAKSDGFRGKMCSSASSTSEETGSEGGGE
WVGPSEEELFSRTHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A7KAX9	0.040	0.033	5.747E-2	2087	0.157	0.105	A7KAX9.pdb.gz	RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32 PE=1 SV=1
2	AFDB:P40068	0.046	0.070	1.258E-1	799	0.092	0.161	P40068.pdb.gz	FLO8_YEAST Transcriptional activator FLO8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FLO8 PE=5 SV=2
3	AFDB:A1ZBW7	0.042	0.041	6.031E-1	1469	0.169	0.161	A1ZBW7.pdb.gz	WASC2_DROME WASH complex subunit 2 OS=Drosophila melanogaster OX=7227 GN=FAM21 PE=1 SV=1
4	AFDB:F1MAK3	0.039	0.029	7.226E-1	2101	0.158	0.105	F1MAK3.pdb.gz	F1MAK3_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=1 SV=2
5	AFDB:M9PDE6	0.034	0.024	7.675E-1	2190	0.140	0.089	M9PDE6.pdb.gz	M9PDE6_DROME Uncharacterized protein, isoform K OS=Drosophila melanogaster OX=7227 GN=CG6448 PE=1 SV=1
6	AFDB:P35658	0.035	0.027	8.658E-1	2090	0.124	0.083	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
7	AFDB:Q05860	0.037	0.035	8.658E-1	1466	0.111	0.106	Q05860.pdb.gz	FMN1_MOUSE Formin-1 OS=Mus musculus OX=10090 GN=Fmn1 PE=1 SV=2
8	AFDB:Q8WYP5	0.037	0.028	8.658E-1	2266	0.143	0.088	Q8WYP5.pdb.gz	ELYS_HUMAN Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3
9	AFDB:Q00083	0.033	0.029	9.196E-1	1676	0.122	0.101	Q00083.pdb.gz	APSA_EMENI Anucleate primary sterigmata protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=apsA PE=1 SV=2
10	AFDB:Q6AWQ1	0.037	0.049	9.196E-1	954	0.090	0.131	Q6AWQ1.pdb.gz	Q6AWQ1_DROME RE71183p OS=Drosophila melanogaster OX=7227 GN=Srrm1 PE=2 SV=1
11	PDB:4zzlA	0.052	0.268	2.723	146	0.018	0.171	4zzlA.pdb.gz
12	PDB:5lqwA	0.040	0.028	2.892	2130	0.008	0.005	5lqwA.pdb.gz	Molecular architecture of the Saccharomyces cerevisiae activated spliceosome
13	PDB:6tz402	0.041	0.203	3.071	176	0.009	0.074	6tz402.pdb.gz
14	PDB:6ke6RQ	0.022	0.094	4.152	226	0.020	0.124	6ke6RQ.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
15	PDB:4adnA	0.025	0.129	4.684	213	0.006	0.042	4adnA.pdb.gz	Structure and Function of Fusb: An Elongation Factor G-Binding Fusidic Acid Resistance Protein Active in Ribosomal Translocation and Recycling
16	PDB:4rwtD	0.024	0.091	4.684	280	0.014	0.068	4rwtD.pdb.gz	Mechanisms of leiomodin 2-mediated regulation of actin filament in muscle cells.
17	PDB:7emfK	0.038	0.312	4.975	112	0.006	0.071	7emfK.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
18	PDB:6hizCI	0.037	0.204	6.331	222	0.012	0.077	6hizCI.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
19	PDB:7enah	0.032	0.169	6.331	190	0.014	0.100	7enah.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
20	PDB:4rerA	0.034	0.074	6.724	459	0.011	0.035	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UYC0	3.2	34.7	513	0.016	0.043	PPM1H_MOUSE Protein phosphatase 1H OS=Mus musculus OX=10090 GN=Ppm1h PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15376 DUF4603	0	2375.6	Domain of unknown function (DUF4603)
2	PF14400 Transglut_i_TM	24	16.4	Inactive transglutaminase fused to 7 transmembrane helices

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303928

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345163	0.774	Olfactory receptor 51F1
2	9606.ENSP00000358966	0.612	Interphotoreceptor matrix proteoglycan 1
3	9606.ENSP00000339251	0.521	Keratinocyte differentiation-associated protein
4	9606.ENSP00000381932	0.508	Dual specificity tyrosine-phosphorylation-regulated kinase 1A
5	9606.ENSP00000320649	0.506	Coiled-coil domain containing 89

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.352	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.980	cellular process
GO:0044238	0.979	primary metabolic process
GO:0071704	0.973	organic substance metabolic process
GO:0006807	0.973	nitrogen compound metabolic process
GO:0050789	0.848	regulation of biological process
GO:0043170	0.834	macromolecule metabolic process
GO:0044237	0.819	cellular metabolic process
GO:0050794	0.694	regulation of cellular process
GO:0032501	0.508	multicellular organismal process
GO:1901564	0.428	organonitrogen compound metabolic process
GO:0048518	0.416	positive regulation of biological process
GO:0043412	0.404	macromolecule modification
GO:0032502	0.338	developmental process
GO:0019538	0.333	protein metabolic process
GO:0048522	0.330	positive regulation of cellular process
GO:0048519	0.310	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.998	intracellular organelle
GO:0005737	0.997	cytoplasm
GO:0043231	0.992	intracellular membrane-bounded organelle
GO:0005634	0.983	nucleus
GO:0005829	0.963	cytosol
GO:0070013	0.921	intracellular organelle lumen
GO:0031981	0.860	nuclear lumen
GO:0032991	0.846	protein-containing complex
GO:0043228	0.840	non-membrane-bounded organelle
GO:0043232	0.817	intracellular non-membrane-bounded organelle
GO:0005654	0.598	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]