StarFunc result for job id Q92633

User Input

>input (364 residues)
MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVC
IFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST
WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA
IPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS
RHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA
EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSND
HSVV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P61793	0.943	0.943	5.134E-46	364	0.973	0.973	P61793.pdb.gz	LPAR1_MOUSE Lysophosphatidic acid receptor 1 OS=Mus musculus OX=10090 GN=Lpar1 PE=1 SV=1
2	AFDB:Q7ZZ93	0.885	0.930	6.553E-41	346	0.846	0.890	Q7ZZ93.pdb.gz
3	PDB:7td1R	0.761	0.938	4.646E-32	293	0.805	1.000	7td1R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
4	AFDB:F1Q734	0.833	0.822	5.842E-31	369	0.525	0.518	F1Q734.pdb.gz
5	AFDB:F1QFF1	0.837	0.855	1.298E-29	356	0.495	0.506	F1QFF1.pdb.gz	F1QFF1_DANRE Lysophosphatidic acid receptor 2 isoform X1 OS=Danio rerio OX=7955 GN=zgc:101053 PE=3 SV=1
6	PDB:7yu4A	0.704	0.955	1.556E-29	266	0.728	0.996	7yu4A.pdb.gz	Structure of the active G i -coupled human lysophosphatidic acid receptor 1 complexed with a potent agonist.
7	AFDB:Q9HBW0	0.840	0.871	1.118E-28	351	0.486	0.504	Q9HBW0.pdb.gz	LPAR2_HUMAN Lysophosphatidic acid receptor 2 OS=Homo sapiens OX=9606 GN=LPAR2 PE=1 SV=3
8	AFDB:Q8K5E0	0.816	0.838	1.759E-27	354	0.486	0.500	Q8K5E0.pdb.gz	LPAR3_RAT Lysophosphatidic acid receptor 3 OS=Rattus norvegicus OX=10116 GN=Lpar3 PE=2 SV=1
9	AFDB:A0A0R4IY24	0.663	0.853	2.379E-27	280	0.635	0.825	A0A0R4IY24.pdb.gz
10	AFDB:A0A0R4IAQ2	0.834	0.859	9.039E-27	353	0.429	0.442	A0A0R4IAQ2.pdb.gz
11	AFDB:Q9DDK4	0.827	0.832	9.712E-22	362	0.363	0.365	Q9DDK4.pdb.gz	S1PR1_DANRE Sphingosine 1-phosphate receptor 1 OS=Danio rerio OX=7955 GN=s1pr1 PE=2 SV=2
12	AFDB:P48303	0.779	0.742	5.438E-21	383	0.346	0.329	P48303.pdb.gz	S1PR1_RAT Sphingosine 1-phosphate receptor 1 OS=Rattus norvegicus OX=10116 GN=S1pr1 PE=1 SV=1
13	PDB:7td3R	0.711	0.876	1.026E-19	292	0.321	0.401	7td3R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
14	PDB:3v2yA	0.720	0.581	9.887E-16	455	0.321	0.257	3v2yA.pdb.gz	Crystal structure of a lipid G protein-coupled receptor.
15	PDB:7ew2R	0.706	0.872	2.241E-15	290	0.308	0.386	7ew2R.pdb.gz	Structural insights into sphingosine-1-phosphate recognition and ligand selectivity of S1PR3-Gi signaling complexes.
16	PDB:7t6bR	0.655	0.886	4.879E-13	264	0.261	0.360	7t6bR.pdb.gz	Structure of S1PR2-heterotrimeric G 13 signaling complex.
17	PDB:7wv9R	0.674	0.831	3.693E-12	290	0.236	0.297	7wv9R.pdb.gz	Molecular mechanism of allosteric modulation for the cannabinoid receptor CB1.
18	PDB:7f53R	0.617	0.805	1.530E-11	273	0.209	0.278	7f53R.pdb.gz	Structural insights into ligand recognition and activation of the melanocortin-4 receptor.
19	PDB:6pt0R	0.697	0.841	4.893E-11	298	0.198	0.242	6pt0R.pdb.gz	Cryo-EM Structure of the Human Cannabinoid Receptor CB2-GiSignaling Complex.
20	PDB:7e32R	0.581	0.726	3.547E-10	285	0.179	0.228	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61793	0.0	735	364	0.973	0.973	LPAR1_MOUSE Lysophosphatidic acid receptor 1 OS=Mus musculus OX=10090 GN=Lpar1 PE=1 SV=1
2	P61794	0.0	735	364	0.973	0.973	LPAR1_RAT Lysophosphatidic acid receptor 1 OS=Rattus norvegicus OX=10116 GN=Lpar1 PE=1 SV=1
3	Q6DHQ8	0.0	633	346	0.849	0.893	Q6DHQ8_DANRE Lysophosphatidic acid receptor 1 OS=Danio rerio OX=7955 GN=edg2 PE=2 SV=1
4	Q92633	0.0	753	364	1.000	1.000	LPAR1_HUMAN Lysophosphatidic acid receptor 1 OS=Homo sapiens OX=9606 GN=LPAR1 PE=1 SV=3
5	F1QFF1	3.66e-131	381	356	0.500	0.511	F1QFF1_DANRE Lysophosphatidic acid receptor 2 isoform X1 OS=Danio rerio OX=7955 GN=zgc:101053 PE=3 SV=1
6	Q6DC27	1.04e-129	377	356	0.497	0.508	Q6DC27_DANRE Lysophosphatidic acid receptor 2 OS=Danio rerio OX=7955 GN=zgc:101053 PE=2 SV=1
7	Q9JL06	1.33e-122	359	348	0.484	0.506	LPAR2_MOUSE Lysophosphatidic acid receptor 2 OS=Mus musculus OX=10090 GN=Lpar2 PE=2 SV=2
8	Q9HBW0	3.69e-122	358	348	0.484	0.506	LPAR2_HUMAN Lysophosphatidic acid receptor 2 OS=Homo sapiens OX=9606 GN=LPAR2 PE=1 SV=3
9	Q8K5E0	4.77e-122	358	354	0.500	0.514	LPAR3_RAT Lysophosphatidic acid receptor 3 OS=Rattus norvegicus OX=10116 GN=Lpar3 PE=2 SV=1
10	Q9EQ31	5.03e-121	355	354	0.492	0.506	LPAR3_MOUSE Lysophosphatidic acid receptor 3 OS=Mus musculus OX=10090 GN=Lpar3 PE=1 SV=1
11	Q9UBY5	3.77e-120	353	353	0.484	0.499	LPAR3_HUMAN Lysophosphatidic acid receptor 3 OS=Homo sapiens OX=9606 GN=LPAR3 PE=1 SV=1
12	K9M3I1	1.17e-102	308	353	0.442	0.456	K9M3I1_DANRE Lysophosphatidic acid receptor 1 OS=Danio rerio OX=7955 GN=Lpar3 PE=2 SV=1
13	Q9DDK4	3.45e-76	241	362	0.360	0.362	S1PR1_DANRE Sphingosine 1-phosphate receptor 1 OS=Danio rerio OX=7955 GN=s1pr1 PE=2 SV=2
14	O08530	8.23e-76	241	382	0.360	0.343	S1PR1_MOUSE Sphingosine 1-phosphate receptor 1 OS=Mus musculus OX=10090 GN=S1pr1 PE=1 SV=3
15	P21453	1.09e-75	240	382	0.338	0.322	S1PR1_HUMAN Sphingosine 1-phosphate receptor 1 OS=Homo sapiens OX=9606 GN=S1PR1 PE=1 SV=2
16	P48303	2.54e-75	239	383	0.360	0.342	S1PR1_RAT Sphingosine 1-phosphate receptor 1 OS=Rattus norvegicus OX=10116 GN=S1pr1 PE=1 SV=1
17	Q99500	1.08e-66	217	378	0.319	0.307	S1PR3_HUMAN Sphingosine 1-phosphate receptor 3 OS=Homo sapiens OX=9606 GN=S1PR3 PE=1 SV=2
18	Q9Z0U9	1.76e-65	214	378	0.299	0.288	S1PR3_MOUSE Sphingosine 1-phosphate receptor 3 OS=Mus musculus OX=10090 GN=S1pr3 PE=2 SV=1
19	Q9I8K8	1.39e-62	206	370	0.327	0.322	S1PR2_DANRE Sphingosine 1-phosphate receptor 2 OS=Danio rerio OX=7955 GN=s1pr2 PE=1 SV=1
20	P47752	9.66e-60	198	352	0.308	0.318	S1PR2_RAT Sphingosine 1-phosphate receptor 2 OS=Rattus norvegicus OX=10116 GN=S1pr2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	1.8e-35	134.1	7 transmembrane receptor (rhodopsin family)
2	PF13853 7tm_4	4.2	18.7	Olfactory receptor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363553

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000408205	0.984	Lysophosphatidic acid receptor 4
2	9606.ENSP00000327875	0.982	Lysophosphatidic acid receptor 5
3	9606.ENSP00000242786	0.977	CD97 antigen
4	9606.ENSP00000275364	0.967	Guanine nucleotide-binding protein subunit alpha-12
5	9606.ENSP00000367691	0.960	Lysophosphatidic acid receptor 6
6	9606.ENSP00000400717	0.948	Guanine nucleotide-binding protein subunit alpha-13
7	9606.ENSP00000259486	0.946	Ectonucleotide pyrophosphatase/phosphodiesterase family member 2
8	9606.ENSP00000343027	0.946	Guanine nucleotide-binding protein G(i) subunit alpha-1
9	9606.ENSP00000275493	0.935	Epidermal growth factor receptor
10	9606.ENSP00000306512	0.933	Interleukin-8
11	9606.ENSP00000263088	0.930	Phospholipase D2
12	9606.ENSP00000360266	0.929	Transcription factor AP-1
13	9606.ENSP00000262494	0.927	Guanine nucleotide-binding protein G(o) subunit alpha
14	9606.ENSP00000358867	0.927	Guanine nucleotide-binding protein G(k) subunit alpha
15	9606.ENSP00000312999	0.924	Guanine nucleotide-binding protein G(i) subunit alpha-2
16	9606.ENSP00000354718	0.915	A-kinase anchor protein 13
17	9606.ENSP00000306245	0.914	Proto-oncogene c-Fos
18	9606.ENSP00000311032	0.913	Caspase-3
19	9606.ENSP00000481878	0.912	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
20	9606.ENSP00000334448	0.911	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0045125	0.995	bioactive lipid receptor activity
GO:0005488	0.987	binding
GO:0005515	0.969	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0050896	0.989	response to stimulus
GO:0007165	0.977	signal transduction
GO:0007186	0.965	G protein-coupled receptor signaling pathway
GO:0032501	0.957	multicellular organismal process
GO:0032502	0.924	developmental process
GO:0023051	0.920	regulation of signaling
GO:0010646	0.914	regulation of cell communication
GO:0048856	0.907	anatomical structure development
GO:1902531	0.895	regulation of intracellular signal transduction
GO:0048518	0.810	positive regulation of biological process
GO:0048522	0.792	positive regulation of cellular process
GO:0051336	0.784	regulation of hydrolase activity
GO:1902533	0.773	positive regulation of intracellular signal transduction
GO:0051345	0.770	positive regulation of hydrolase activity
GO:0007275	0.766	multicellular organism development
GO:0007204	0.754	positive regulation of cytosolic calcium ion concentration
GO:0050793	0.670	regulation of developmental process
GO:0048731	0.649	system development
GO:0060191	0.615	regulation of lipase activity
GO:0010863	0.610	positive regulation of phospholipase C activity
GO:0048519	0.528	negative regulation of biological process
GO:0042221	0.517	response to chemical
GO:0048523	0.448	negative regulation of cellular process
GO:0070887	0.348	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.952	intracellular anatomical structure
GO:0043226	0.938	organelle
GO:0005737	0.934	cytoplasm
GO:0043227	0.894	membrane-bounded organelle
GO:0043229	0.847	intracellular organelle
GO:0043231	0.773	intracellular membrane-bounded organelle
GO:0031982	0.640	vesicle
GO:0012505	0.409	endomembrane system
GO:0031410	0.384	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]