StarFunc result for job id Q92637

User Input

>input (280 residues)
MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNG
TATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFMEGEPL
ALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAG
ISQYTVKGLQLPTPVWFHVLFYLAVGIMFLVNTVLWVTIRKELKRKKKWNLEISLDSGHE
KKVISSLQEDRHLEEELKCQEQKEEQLQEGVHRKEPQGAT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92637	1.000	1.000	9.187E-50	280	1.000	1.000	Q92637.pdb.gz	FCGRB_HUMAN Putative high affinity immunoglobulin gamma Fc receptor IB OS=Homo sapiens OX=9606 GN=FCGR1BP PE=5 SV=1
2	AFDB:P12314	0.591	0.444	9.800E-42	374	0.979	0.733	P12314.pdb.gz	FCGR1_HUMAN High affinity immunoglobulin gamma Fc receptor I OS=Homo sapiens OX=9606 GN=FCGR1A PE=1 SV=2
3	AFDB:P26151	0.575	0.402	3.028E-28	404	0.571	0.396	P26151.pdb.gz	FCGR1_MOUSE High affinity immunoglobulin gamma Fc receptor I OS=Mus musculus OX=10090 GN=Fcgr1 PE=1 SV=1
4	AFDB:A0A0B4J2J0	0.571	0.455	1.144E-26	353	0.543	0.431	A0A0B4J2J0.pdb.gz	A0A0B4J2J0_RAT Fc fragment of IgG receptor Ia OS=Rattus norvegicus OX=10116 GN=Fcgr1a PE=4 SV=1
5	AFDB:A0A0B4J1G0	0.638	0.710	3.214E-24	249	0.325	0.365	A0A0B4J1G0.pdb.gz	FCG3A_MOUSE Low affinity immunoglobulin gamma Fc region receptor III-A OS=Mus musculus OX=10090 GN=Fcgr4 PE=1 SV=1
6	AFDB:P08508	0.571	0.606	4.958E-24	261	0.343	0.368	P08508.pdb.gz	FCGR3_MOUSE Low affinity immunoglobulin gamma Fc region receptor III OS=Mus musculus OX=10090 GN=Fcgr3 PE=1 SV=1
7	AFDB:P27645	0.594	0.620	2.030E-23	267	0.361	0.378	P27645.pdb.gz	FCGR3_RAT Low affinity immunoglobulin gamma Fc region receptor III OS=Rattus norvegicus OX=10116 GN=Fcgr3 PE=2 SV=1
8	AFDB:A0A1W2PQB1	0.531	0.514	2.521E-23	290	0.307	0.297	A0A1W2PQB1.pdb.gz	A0A1W2PQB1_HUMAN Fc of IgG low affinity IIIa receptor isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=FCGR3A PE=1 SV=1
9	AFDB:Q6XPU4	0.591	0.659	2.662E-23	249	0.329	0.369	Q6XPU4.pdb.gz	FCG3A_RAT Low affinity immunoglobulin gamma Fc region receptor III-A OS=Rattus norvegicus OX=10116 GN=Fcgr3a PE=2 SV=1
10	AFDB:Q63203	0.590	0.580	6.002E-23	285	0.289	0.284	Q63203.pdb.gz	FCGR2_RAT Low affinity immunoglobulin gamma Fc region receptor II OS=Rattus norvegicus OX=10116 GN=Fcgr2 PE=1 SV=1
11	PDB:1seqL	0.225	0.293	5.399E-7	208	0.125	0.168	1seqL.pdb.gz
12	PDB:6dldD	0.215	0.222	6.018E-7	269	0.111	0.115	6dldD.pdb.gz
13	PDB:5c6wJ	0.248	0.288	8.795E-7	238	0.125	0.147	5c6wJ.pdb.gz
14	PDB:3o11A	0.214	0.269	1.218E-6	212	0.125	0.165	3o11A.pdb.gz
15	PDB:1cf8L	0.230	0.279	1.285E-6	215	0.139	0.181	1cf8L.pdb.gz	Convergence of Catalytic Antibody and Terpene Cyclase Mechanisms: Polyene Cyclization Directed by Carbocation-pi Interactions
16	PDB:1k4dB	0.222	0.282	1.433E-6	212	0.129	0.170	1k4dB.pdb.gz
17	PDB:4xnyL	0.241	0.309	1.512E-6	211	0.121	0.161	4xnyL.pdb.gz
18	PDB:3u7wL	0.220	0.272	1.597E-6	210	0.104	0.138	3u7wL.pdb.gz
19	PDB:6au5C	0.219	0.278	1.686E-6	213	0.114	0.150	6au5C.pdb.gz	Meditope-Fab interaction: threading the hole.
20	PDB:1f11A	0.231	0.288	1.779E-6	216	0.111	0.144	1f11A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q92637	0.0	581	280	1.000	1.000	FCGRB_HUMAN Putative high affinity immunoglobulin gamma Fc receptor IB OS=Homo sapiens OX=9606 GN=FCGR1BP PE=5 SV=1
2	P12314	1.65e-134	387	374	0.671	0.503	FCGR1_HUMAN High affinity immunoglobulin gamma Fc receptor I OS=Homo sapiens OX=9606 GN=FCGR1A PE=1 SV=2
3	P26151	7.75e-84	259	404	0.461	0.319	FCGR1_MOUSE High affinity immunoglobulin gamma Fc receptor I OS=Mus musculus OX=10090 GN=Fcgr1 PE=1 SV=1
4	A0A0B4J2J0	4.17e-75	234	353	0.429	0.340	A0A0B4J2J0_RAT Fc fragment of IgG receptor Ia OS=Rattus norvegicus OX=10116 GN=Fcgr1a PE=4 SV=1
5	P08508	3.60e-55	181	261	0.318	0.341	FCGR3_MOUSE Low affinity immunoglobulin gamma Fc region receptor III OS=Mus musculus OX=10090 GN=Fcgr3 PE=1 SV=1
6	A0A0B4J1G0	6.48e-55	179	249	0.332	0.373	FCG3A_MOUSE Low affinity immunoglobulin gamma Fc region receptor III-A OS=Mus musculus OX=10090 GN=Fcgr4 PE=1 SV=1
7	P27645	5.01e-54	178	267	0.325	0.341	FCGR3_RAT Low affinity immunoglobulin gamma Fc region receptor III OS=Rattus norvegicus OX=10116 GN=Fcgr3 PE=2 SV=1
8	Q6XPU4	8.11e-54	177	249	0.300	0.337	FCG3A_RAT Low affinity immunoglobulin gamma Fc region receptor III-A OS=Rattus norvegicus OX=10116 GN=Fcgr3a PE=2 SV=1
9	O75015	1.32e-53	176	233	0.314	0.378	FCG3B_HUMAN Low affinity immunoglobulin gamma Fc region receptor III-B OS=Homo sapiens OX=9606 GN=FCGR3B PE=1 SV=2
10	P08637	1.38e-52	174	254	0.307	0.339	FCG3A_HUMAN Low affinity immunoglobulin gamma Fc region receptor III-A OS=Homo sapiens OX=9606 GN=FCGR3A PE=1 SV=2
11	A0A1W2PQB1	5.72e-52	173	290	0.307	0.297	A0A1W2PQB1_HUMAN Fc of IgG low affinity IIIa receptor isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=FCGR3A PE=1 SV=1
12	A3RFZ7	2.50e-51	171	254	0.307	0.339	FCG3A_MACMU Low affinity immunoglobulin gamma Fc region receptor III-A OS=Macaca mulatta OX=9544 GN=FCGR3A PE=1 SV=1
13	P08101	7.89e-50	169	330	0.321	0.273	FCGR2_MOUSE Low affinity immunoglobulin gamma Fc region receptor II OS=Mus musculus OX=10090 GN=Fcgr2 PE=1 SV=2
14	P12319	4.31e-46	157	257	0.300	0.327	FCERA_HUMAN High affinity immunoglobulin epsilon receptor subunit alpha OS=Homo sapiens OX=9606 GN=FCER1A PE=1 SV=1
15	Q63203	1.58e-45	156	285	0.279	0.274	FCGR2_RAT Low affinity immunoglobulin gamma Fc region receptor II OS=Rattus norvegicus OX=10116 GN=Fcgr2 PE=1 SV=1
16	P31994	3.02e-45	156	310	0.296	0.268	FCG2B_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-b OS=Homo sapiens OX=9606 GN=FCGR2B PE=1 SV=2
17	P31995	4.30e-45	156	323	0.296	0.257	FCG2C_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-c OS=Homo sapiens OX=9606 GN=FCGR2C PE=1 SV=1
18	P12318	3.63e-44	154	317	0.264	0.233	FCG2A_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-a OS=Homo sapiens OX=9606 GN=FCGR2A PE=1 SV=4
19	P20489	7.87e-39	138	250	0.314	0.352	FCERA_MOUSE High affinity immunoglobulin epsilon receptor subunit alpha OS=Mus musculus OX=10090 GN=Fcer1a PE=2 SV=2
20	Q6BAA4	8.44e-38	140	426	0.279	0.183	FCRLB_HUMAN Fc receptor-like B OS=Homo sapiens OX=9606 GN=FCRLB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	2.5e+02	12.9	Adenovirus E3 region protein CR1
2	PF07679 I-set	0.08	24.3	Immunoglobulin I-set domain
3	PF00047 ig	0.51	21.9	Immunoglobulin domain
4	PF13895 Ig_2	6.4e-18	76.2	Immunoglobulin domain
5	PF13927 Ig_3	3.9e-13	61.1	Immunoglobulin domain
6	PF16680 Ig_4	0.42	22.5	T-cell surface glycoprotein CD3 delta chain
7	PF16706 Izumo-Ig	2.6e+02	12.9	Izumo-like Immunoglobulin domain
8	PF15099 PIRT	14	16.8	Phosphoinositide-interacting protein family
9	PF07686 V-set	0.00022	32.7	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358391

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358165	0.834	High affinity immunoglobulin gamma Fc receptor I
2	9606.ENSP00000302665	0.789	Insulin-like growth factor I
3	9606.ENSP00000289902	0.772	High affinity immunoglobulin epsilon receptor subunit gamma
4	9606.ENSP00000262629	0.697	TYRO protein tyrosine kinase-binding protein
5	9606.ENSP00000268035	0.664	Insulin-like growth factor 1 receptor
6	9606.ENSP00000255030	0.603	C-reactive protein
7	9606.ENSP00000455897	0.600	Macrophage mannose receptor 1
8	9606.ENSP00000391826	0.566	Insulin-like growth factor II
9	9606.ENSP00000269571	0.529	Receptor tyrosine-protein kinase erbB-2
10	9606.ENSP00000386378	0.525	C-type lectin domain family 4 member K
11	9606.ENSP00000451828	0.524	RAC-alpha serine/threonine-protein kinase
12	9606.ENSP00000275493	0.520	Epidermal growth factor receptor
13	9606.ENSP00000343847	0.502	Serine/threonine-protein kinase Nek10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140375	0.998	immune receptor activity
GO:0004888	0.988	transmembrane signaling receptor activity
GO:0044877	0.868	protein-containing complex binding
GO:0019865	0.561	immunoglobulin binding
GO:0005102	0.469	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0050789	0.997	regulation of biological process
GO:0009987	0.994	cellular process
GO:0048518	0.990	positive regulation of biological process
GO:0050794	0.989	regulation of cellular process
GO:0002252	0.982	immune effector process
GO:0007154	0.966	cell communication
GO:0048583	0.962	regulation of response to stimulus
GO:0007165	0.933	signal transduction
GO:0006950	0.927	response to stress
GO:0002682	0.921	regulation of immune system process
GO:0051179	0.920	localization
GO:0048584	0.901	positive regulation of response to stimulus
GO:0006955	0.898	immune response
GO:0051234	0.892	establishment of localization
GO:0006952	0.876	defense response
GO:0006810	0.875	transport
GO:0002443	0.815	leukocyte mediated immunity
GO:0019222	0.799	regulation of metabolic process
GO:0016192	0.796	vesicle-mediated transport
GO:0048522	0.787	positive regulation of cellular process
GO:0031347	0.777	regulation of defense response
GO:0006954	0.773	inflammatory response
GO:0060255	0.771	regulation of macromolecule metabolic process
GO:0050776	0.762	regulation of immune response
GO:0009893	0.761	positive regulation of metabolic process
GO:0002684	0.759	positive regulation of immune system process
GO:0032101	0.735	regulation of response to external stimulus
GO:0051239	0.729	regulation of multicellular organismal process
GO:0002250	0.707	adaptive immune response
GO:0010604	0.705	positive regulation of macromolecule metabolic process
GO:0007166	0.700	cell surface receptor signaling pathway
GO:0050727	0.691	regulation of inflammatory response
GO:0051240	0.686	positive regulation of multicellular organismal process
GO:0002460	0.678	adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0002449	0.664	lymphocyte mediated immunity
GO:0002697	0.645	regulation of immune effector process
GO:0050778	0.620	positive regulation of immune response
GO:0010646	0.602	regulation of cell communication
GO:0023051	0.601	regulation of signaling
GO:0016064	0.597	immunoglobulin mediated immune response
GO:0002703	0.586	regulation of leukocyte mediated immunity
GO:0032501	0.572	multicellular organismal process
GO:0002437	0.556	inflammatory response to antigenic stimulus
GO:0002706	0.547	regulation of lymphocyte mediated immunity
GO:0002673	0.537	regulation of acute inflammatory response
GO:0042221	0.532	response to chemical
GO:0009966	0.516	regulation of signal transduction
GO:0006897	0.506	endocytosis
GO:0002444	0.505	myeloid leukocyte mediated immunity
GO:0031323	0.505	regulation of cellular metabolic process
GO:0031325	0.503	positive regulation of cellular metabolic process
GO:0002861	0.497	regulation of inflammatory response to antigenic stimulus
GO:0080090	0.495	regulation of primary metabolic process
GO:0051171	0.487	regulation of nitrogen compound metabolic process
GO:0070887	0.461	cellular response to chemical stimulus
GO:0010468	0.455	regulation of gene expression
GO:0002822	0.454	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0050790	0.445	regulation of catalytic activity
GO:0032879	0.431	regulation of localization
GO:0051049	0.421	regulation of transport
GO:0048519	0.390	negative regulation of biological process
GO:0002712	0.377	regulation of B cell mediated immunity
GO:0043085	0.368	positive regulation of catalytic activity
GO:0042325	0.365	regulation of phosphorylation
GO:0051347	0.359	positive regulation of transferase activity
GO:0043549	0.355	regulation of kinase activity
GO:0023056	0.348	positive regulation of signaling
GO:0010647	0.348	positive regulation of cell communication
GO:0051050	0.344	positive regulation of transport
GO:0042327	0.338	positive regulation of phosphorylation
GO:0051173	0.336	positive regulation of nitrogen compound metabolic process
GO:0051246	0.332	regulation of protein metabolic process
GO:0008152	0.331	metabolic process
GO:0010033	0.326	response to organic substance
GO:0009605	0.319	response to external stimulus
GO:0048523	0.318	negative regulation of cellular process
GO:0009967	0.314	positive regulation of signal transduction
GO:0031401	0.312	positive regulation of protein modification process
GO:1902531	0.311	regulation of intracellular signal transduction
GO:0071310	0.310	cellular response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.996	membrane-bounded organelle
GO:0012505	0.995	endomembrane system
GO:0043229	0.990	intracellular organelle
GO:0031982	0.986	vesicle
GO:0043231	0.983	intracellular membrane-bounded organelle
GO:0005737	0.970	cytoplasm
GO:0097708	0.936	intracellular vesicle
GO:0031410	0.915	cytoplasmic vesicle
GO:0031090	0.879	organelle membrane
GO:0030659	0.825	cytoplasmic vesicle membrane
GO:0098588	0.769	bounding membrane of organelle
GO:0005769	0.601	early endosome
GO:0031901	0.591	early endosome membrane
GO:0030136	0.575	clathrin-coated vesicle
GO:0030139	0.571	endocytic vesicle
GO:0030665	0.526	clathrin-coated vesicle membrane
GO:0030669	0.461	clathrin-coated endocytic vesicle membrane
GO:0032991	0.383	protein-containing complex
GO:0009986	0.349	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]