StarFunc result for job id Q92643

User Input

>input (395 residues)
MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLVCTSRFWFNYR
HVANTLSVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDDVEVD
YRSYEVTVENFLRVLTGRIPPSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITN
IELADAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPA
IGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSLCVSTPGHRTDLFQRDPKNVLI
TDFFGSVRKVEITTETIKLQQDSEIMESSYKEDQMDEKLMEPLKYAEQLPVAQIIHQKPK
LKDWHPPGGFILGLWALIIMVFFKTYGIKHMKFIF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92643	1.000	1.000	2.358E-83	395	1.000	1.000	Q92643.pdb.gz	GPI8_HUMAN GPI-anchor transamidase OS=Homo sapiens OX=9606 GN=PIGK PE=1 SV=2
2	AFDB:Q6IQM5	0.789	0.801	2.411E-70	389	0.792	0.805	Q6IQM5.pdb.gz	Q6IQM5_DANRE GPI-anchor transamidase OS=Danio rerio OX=7955 GN=zgc:86702 PE=1 SV=1
3	AFDB:Q8T4E1	0.713	0.792	4.098E-53	355	0.501	0.558	Q8T4E1.pdb.gz	GPI8_DROME Putative GPI-anchor transamidase OS=Drosophila melanogaster OX=7227 GN=PIG-K PE=2 SV=1
4	AFDB:Q59PU4	0.685	0.706	3.683E-49	383	0.438	0.452	Q59PU4.pdb.gz	Q59PU4_CANAL GPI-anchor transamidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI8 PE=3 SV=1
5	AFDB:Q9USP5	0.696	0.723	8.261E-47	380	0.413	0.429	Q9USP5.pdb.gz	GPI8_SCHPO GPI-anchor transamidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi8 PE=2 SV=1
6	AFDB:Q8GYI6	0.694	0.706	1.271E-46	388	0.463	0.472	Q8GYI6.pdb.gz	Q8GYI6_ARATH Peptidase C13 family OS=Arabidopsis thaliana OX=3702 GN=GPI8 PE=1 SV=1
7	AFDB:P49018	0.674	0.648	7.112E-46	411	0.441	0.423	P49018.pdb.gz	GPI8_YEAST GPI-anchor transamidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI8 PE=1 SV=1
8	AFDB:Q388L3	0.639	0.786	8.745E-33	319	0.273	0.339	Q388L3.pdb.gz	Q388L3_TRYB2 GPI-anchor transamidase subunit 8 (GPI8) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.3060 PE=3 SV=1
9	AFDB:B8JHW0	0.619	0.560	5.057E-24	438	0.205	0.185	B8JHW0.pdb.gz
10	AFDB:O89017	0.605	0.551	1.730E-23	435	0.195	0.177	O89017.pdb.gz	LGMN_MOUSE Legumain OS=Mus musculus OX=10090 GN=Lgmn PE=1 SV=1
11	PDB:4fguA	0.610	0.593	2.113E-23	407	0.203	0.197	4fguA.pdb.gz
12	PDB:5nijA	0.599	0.555	6.674E-20	428	0.187	0.173	5nijA.pdb.gz
13	PDB:4iyrB	0.345	0.663	7.065E-6	191	0.078	0.162	4iyrB.pdb.gz
14	PDB:4nblA	0.390	0.572	2.138E-5	258	0.099	0.151	4nblA.pdb.gz	Tailoring small molecules for an allosteric site on procaspase-6.
15	PDB:4pryA	0.339	0.504	2.907E-5	249	0.084	0.133	4pryA.pdb.gz	Selective inhibition of initiator versus executioner caspases using small peptides containing unnatural amino acids.
16	PDB:4fdlB	0.356	0.561	3.497E-5	239	0.076	0.126	4fdlB.pdb.gz
17	PDB:6w8tB	0.405	0.470	8.055E-4	335	0.106	0.125	6w8tB.pdb.gz
18	PDB:7wzsB	0.358	0.647	1.239E-3	206	0.056	0.107	7wzsB.pdb.gz
19	PDB:2wdpD	0.287	0.455	1.401E-3	230	0.081	0.139	2wdpD.pdb.gz
20	PDB:6w8rA	0.411	0.444	7.375E-3	364	0.101	0.110	6w8rA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6IQM5	0.0	653	389	0.792	0.805	Q6IQM5_DANRE GPI-anchor transamidase OS=Danio rerio OX=7955 GN=zgc:86702 PE=1 SV=1
2	Q92643	0.0	830	395	1.000	1.000	GPI8_HUMAN GPI-anchor transamidase OS=Homo sapiens OX=9606 GN=PIGK PE=1 SV=2
3	Q8T4E1	1.18e-147	424	355	0.496	0.552	GPI8_DROME Putative GPI-anchor transamidase OS=Drosophila melanogaster OX=7227 GN=PIG-K PE=2 SV=1
4	P49018	3.83e-120	356	411	0.413	0.397	GPI8_YEAST GPI-anchor transamidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI8 PE=1 SV=1
5	Q8GYI6	2.57e-118	350	388	0.438	0.446	Q8GYI6_ARATH Peptidase C13 family OS=Arabidopsis thaliana OX=3702 GN=GPI8 PE=1 SV=1
6	Q9USP5	9.90e-118	349	380	0.408	0.424	GPI8_SCHPO GPI-anchor transamidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi8 PE=2 SV=1
7	Q59PU4	1.70e-115	343	383	0.425	0.439	Q59PU4_CANAL GPI-anchor transamidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI8 PE=3 SV=1
8	Q388L3	1.10e-64	211	319	0.256	0.317	Q388L3_TRYB2 GPI-anchor transamidase subunit 8 (GPI8) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.3060 PE=3 SV=1
9	Q6NYJ7	2.73e-27	114	438	0.220	0.199	Q6NYJ7_DANRE Legumain OS=Danio rerio OX=7955 GN=zgc:76953 PE=1 SV=1
10	O89017	2.97e-27	114	435	0.197	0.179	LGMN_MOUSE Legumain OS=Mus musculus OX=10090 GN=Lgmn PE=1 SV=1
11	Q9R0J8	7.46e-27	113	435	0.192	0.175	LGMN_RAT Legumain OS=Rattus norvegicus OX=10116 GN=Lgmn PE=1 SV=1
12	G1SPJ6	1.52e-26	112	435	0.197	0.179	G1SPJ6_RABIT Legumain OS=Oryctolagus cuniculus OX=9986 GN=LGMN PE=3 SV=1
13	F1SD70	4.29e-26	110	438	0.200	0.180	F1SD70_PIG Legumain OS=Sus scrofa OX=9823 GN=LGMN PE=1 SV=4
14	Q99538	4.04e-25	108	433	0.187	0.171	LGMN_HUMAN Legumain OS=Homo sapiens OX=9606 GN=LGMN PE=1 SV=1
15	Q9LJX8	5.07e-25	108	466	0.149	0.127	VPED_ARATH Vacuolar-processing enzyme delta-isozyme OS=Arabidopsis thaliana OX=3702 GN=dVPE PE=1 SV=1
16	R4TUW8	2.47e-24	106	446	0.172	0.152	R4TUW8_ANGCA Asparaginyl endopeptidase OS=Angiostrongylus cantonensis OX=6313 PE=2 SV=1
17	Q84LM2	3.65e-20	94.4	497	0.134	0.107	VPE1_ORYSJ Vacuolar-processing enzyme beta-isozyme 1 OS=Oryza sativa subsp. japonica OX=39947 GN=VPE1 PE=1 SV=1
18	Q39119	4.90e-20	94.0	494	0.157	0.126	VPEG_ARATH Vacuolar-processing enzyme gamma-isozyme OS=Arabidopsis thaliana OX=3702 GN=At4g32940 PE=1 SV=2
19	Q8GS39	1.52e-19	92.4	496	0.147	0.117	REP2_ORYSJ Asparaginyl endopeptidase Rep2 OS=Oryza sativa subsp. japonica OX=39947 GN=REP2 PE=1 SV=1
20	P91430	1.3	33.5	419	0.053	0.050	UBA5_CAEEL Ubiquitin-like modifier-activating enzyme 5 OS=Caenorhabditis elegans OX=6239 GN=uba-5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16487 ArgoMid	24	16.6	Mid domain of argonaute
2	PF01650 Peptidase_C13	6.4e-41	152.1	Peptidase C13 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359848

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000217446	0.999	Phosphatidylinositol glycan anchor biosynthesis class U protein
2	9606.ENSP00000279036	0.999	GPI transamidase component PIG-T
3	9606.ENSP00000309430	0.999	GPI transamidase component PIG-S
4	9606.ENSP00000347206	0.999	Glycosylphosphatidylinositol anchor attachment 1 protein
5	9606.ENSP00000346809	0.977	GPI inositol-deacylase
6	9606.ENSP00000367880	0.955	GPI ethanolamine phosphate transferase 3
7	9606.ENSP00000339328	0.902	Urokinase plasminogen activator surface receptor
8	9606.ENSP00000164305	0.873	GPI mannosyltransferase 3
9	9606.ENSP00000363260	0.857	GPI mannosyltransferase 2
10	9606.ENSP00000357069	0.852	GPI mannosyltransferase 1
11	9606.ENSP00000356702	0.832	Phosphatidylinositol N-acetylglucosaminyltransferase subunit C
12	9606.ENSP00000369820	0.832	Phosphatidylinositol N-acetylglucosaminyltransferase subunit A
13	9606.ENSP00000026218	0.828	Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q
14	9606.ENSP00000225609	0.827	N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
15	9606.ENSP00000420037	0.808	Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
16	9606.ENSP00000267425	0.789	Nucleolar protein 9
17	9606.ENSP00000219548	0.788	E3 ubiquitin-protein ligase CHIP
18	9606.ENSP00000265990	0.788	TATA-binding protein-associated factor 172
19	9606.ENSP00000309096	0.787	Beta-1,4-glucuronyltransferase 1
20	9606.ENSP00000216452	0.772	Phosphatidylinositol N-acetylglucosaminyltransferase subunit H

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0051861	1.000	glycolipid binding
GO:0004197	1.000	cysteine-type endopeptidase activity
GO:0016864	0.993	intramolecular oxidoreductase activity, transposing S-S bonds
GO:0035091	0.987	phosphatidylinositol binding
GO:0003756	0.978	protein disulfide isomerase activity
GO:0003923	0.857	GPI-anchor transamidase activity
GO:0034235	0.310	GPI anchor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044238	0.996	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:1901137	0.993	carbohydrate derivative biosynthetic process
GO:0006664	0.991	glycolipid metabolic process
GO:0046467	0.991	membrane lipid biosynthetic process
GO:0006497	0.990	protein lipidation
GO:0006661	0.989	phosphatidylinositol biosynthetic process
GO:0006506	0.981	GPI anchor biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane
GO:1902494	0.996	catalytic complex
GO:0140534	0.992	endoplasmic reticulum protein-containing complex
GO:0098796	0.990	membrane protein complex
GO:1905368	0.941	peptidase complex
GO:1905369	0.934	endopeptidase complex
GO:0008303	0.924	caspase complex
GO:0042765	0.911	GPI-anchor transamidase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.22.-	1.000	Cysteine endopeptidases.
EC:5.3.4.-	0.993	Transposing S-S bonds.
EC:5.3.4.1	0.978	protein disulfide-isomerase.

[back to server]