StarFunc result for job id Q92673

User Input

>input (2214 residues)
MATRSSRRESRLPFLFTLVALLPPGALCEVWTQRLHGGSAPLPQDRGFLVVQGDPRELRL
WARGDARGASRADEKPLRRKRSAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVAL
ARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFA
DAYAQYLWITFDFCNTLQGFSIPFRAADLLLHSKASNLLLGFDRSHPNKQLWKSDDFGQT
WIMIQEHVKSFSWGIDPYDKPNTIYIERHEPSGYSTVFRSTDFFQSRENQEVILEEVRDF
QLRDKYMFATKVVHLLGSEQQSSVQLWVSFGRKPMRAAQFVTRHPINEYYIADASEDQVF
VCVSHSNNRTNLYISEAEGLKFSLSLENVLYYSPGGAGSDTLVRYFANEPFADFHRVEGL
QGVYIATLINGSMNEENMRSVITFDKGGTWEFLQAPAFTGYGEKINCELSQGCSLHLAQR
LSQLLNLQLRRMPILSKESAPGLIIATGSVGKNLASKTNVYISSSAGARWREALPGPHYY
TWGDHGGIITAIAQGMETNELKYSTNEGETWKTFIFSEKPVFVYGLLTEPGEKSTVFTIF
GSNKENVHSWLILQVNATDALGVPCTENDYKLWSPSDERGNECLLGHKTVFKRRTPHATC
FNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDLSLEVCVPDPEFSGKSYSPPVPCPVGS
TYRRTRGYRKISGDTCSGGDVEARLEGELVPCPLAEENEFILYAVRKSIYRYDLASGATE
QLPLTGLRAAVALDFDYEHNCLYWSDLALDVIQRLCLNGSTGQEVIINSGLETVEALAFE
PLSQLLYWVDAGFKKIEVANPDGDFRLTIVNSSVLDRPRALVLVPQEGVMFWTDWGDLKP
GIYRSNMDGSAAYHLVSEDVKWPNGISVDDQWIYWTDAYLECIERITFSGQQRSVILDNL
PHPYAIAVFKNEIYWDDWSQLSIFRASKYSGSQMEILANQLTGLMDMKIFYKGKNTGSNA
CVPRPCSLLCLPKANNSRSCRCPEDVSSSVLPSGDLMCDCPQGYQLKNNTCVKQENTCLR
NQYRCSNGNCINSIWWCDFDNDCGDMSDERNCPTTICDLDTQFRCQESGTCIPLSYKCDL
EDDCGDNSDESHCEMHQCRSDEYNCSSGMCIRSSWVCDGDNDCRDWSDEANCTAIYHTCE
ASNFQCRNGHCIPQRWACDGDTDCQDGSDEDPVNCEKKCNGFRCPNGTCIPSSKHCDGLR
DCSDGSDEQHCEPLCTHFMDFVCKNRQQCLFHSMVCDGIIQCRDGSDEDAAFAGCSQDPE
FHKVCDEFGFQCQNGVCISLIWKCDGMDDCGDYSDEANCENPTEAPNCSRYFQFRCENGH
CIPNRWKCDRENDCGDWSDEKDCGDSHILPFSTPGPSTCLPNYYRCSSGTCVMDTWVCDG
YRDCADGSDEEACPLLANVTAASTPTQLGRCDRFEFECHQPKTCIPNWKRCDGHQDCQDG
RDEANCPTHSTLTCMSREFQCEDGEACIVLSERCDGFLDCSDESDEKACSDELTVYKVQN
LQWTADFSGDVTLTWMRPKKMPSASCVYNVYYRVVGESIWKTLETHSNKTNTVLKVLKPD
TTYQVKVQVQCLSKAHNTNDFVTLRTPEGLPDAPRNLQLSLPREAEGVIVGHWAPPIHTH
GLIREYIVEYSRSGSKMWASQRAASNFTEIKNLLVNTLYTVRVAAVTSRGIGNWSDSKSI
TTIKGKVIPPPDIHIDSYGENYLSFTLTMESDIKVNGYVVNLFWAFDTHKQERRTLNFRG
SILSHKVGNLTAHTSYEISAWAKTDLGDSPLAFEHVMTRGVRPPAPSLKAKAINQTAVEC
TWTGPRNVVYGIFYATSFLDLYRNPKSLTTSLHNKTVIVSKDEQYLFLVRVVVPYQGPSS
DYVVVKMIPDSRLPPRHLHVVHTGKTSVVIKWESPYDSPDQDLLYAVAVKDLIRKTDRSY
KVKSRNSTVEYTLNKLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDALKIITENDHVL
LFWKSLALKEKHFNESRGYEIHMFDSAMNITAYLGNTTDNFFKISNLKMGHNYTFTVQAR
CLFGNQICGEPAILLYDELGSGADASATQAARSTDVAAVVVPILFLILLSLGVGFAILYT
KHRRLQSSFTAFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88307	0.645	0.645	0.000	2215	0.931	0.931	O88307.pdb.gz	SORL_MOUSE Sortilin-related receptor OS=Mus musculus OX=10090 GN=Sorl1 PE=1 SV=3
2	AFDB:A0A140LH43	0.153	0.264	4.079E-56	1190	0.158	0.294	A0A140LH43.pdb.gz
3	AFDB:Q9EPR5	0.271	0.508	2.587E-55	1159	0.107	0.204	Q9EPR5.pdb.gz	SORC2_MOUSE VPS10 domain-containing receptor SorCS2 OS=Mus musculus OX=10090 GN=Sorcs2 PE=1 SV=2
4	AFDB:Q96PQ0	0.271	0.506	8.452E-55	1159	0.106	0.203	Q96PQ0.pdb.gz	SORC2_HUMAN VPS10 domain-containing receptor SorCS2 OS=Homo sapiens OX=9606 GN=SORCS2 PE=1 SV=3
5	AFDB:Q17R88	0.271	0.481	1.423E-54	1222	0.104	0.188	Q17R88.pdb.gz	Q17R88_HUMAN Sortilin-related VPS10 domain containing receptor 3 OS=Homo sapiens OX=9606 GN=SORCS3 PE=2 SV=1
6	AFDB:Q8WY21	0.264	0.490	1.701E-52	1168	0.097	0.184	Q8WY21.pdb.gz	SORC1_HUMAN VPS10 domain-containing receptor SorCS1 OS=Homo sapiens OX=9606 GN=SORCS1 PE=1 SV=3
7	AFDB:Q8IKV8	0.259	0.617	1.569E-46	895	0.080	0.198	Q8IKV8.pdb.gz	Q8IKV8_PLAF7 Sortilin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1451800 PE=3 SV=1
8	AFDB:F1QTJ4	0.144	0.192	5.126E-46	1615	0.116	0.159	F1QTJ4.pdb.gz	F1QTJ4_DANRE Low density lipoprotein receptor-related protein 5 OS=Danio rerio OX=7955 GN=LRP6 PE=1 SV=1
9	AFDB:O75197	0.144	0.191	1.043E-45	1615	0.119	0.163	O75197.pdb.gz	LRP5_HUMAN Low-density lipoprotein receptor-related protein 5 OS=Homo sapiens OX=9606 GN=LRP5 PE=1 SV=2
10	AFDB:A0A0G2K0H3	0.140	0.188	1.346E-44	1613	0.121	0.166	A0A0G2K0H3.pdb.gz	A0A0G2K0H3_RAT Low-density lipoprotein receptor-related protein OS=Rattus norvegicus OX=10116 GN=Lrp6 PE=3 SV=1
11	PDB:5nmtB	0.251	0.797	2.773E-40	657	0.090	0.303	5nmtB.pdb.gz
12	PDB:7q1yA	0.071	0.094	2.058E-12	1374	0.033	0.053	7q1yA.pdb.gz
13	PDB:7mq8LT	0.087	0.208	9.368E-12	869	0.030	0.077	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:5a42A	0.069	0.087	1.030E-11	1597	0.033	0.046	5a42A.pdb.gz
15	PDB:5wyjBA	0.094	0.230	1.030E-11	755	0.033	0.095	5wyjBA.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
16	PDB:4ziqA	0.064	0.087	1.577E-11	1450	0.033	0.050	4ziqA.pdb.gz
17	PDB:6jp6A	0.089	0.184	2.920E-11	998	0.047	0.104	6jp6A.pdb.gz
18	PDB:1e07A	0.065	0.159	3.061E-11	642	0.037	0.128	1e07A.pdb.gz
19	PDB:6h03A	0.058	0.088	3.210E-11	1223	0.029	0.052	6h03A.pdb.gz
20	PDB:1nr0A	0.090	0.300	3.700E-11	610	0.040	0.146	1nr0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88307	0.0	4325	2215	0.932	0.932	SORL_MOUSE Sortilin-related receptor OS=Mus musculus OX=10090 GN=Sorl1 PE=1 SV=3
2	P0DSP1	0.0	4315	2215	0.931	0.930	SORL_RAT Sortilin-related receptor OS=Rattus norvegicus OX=10116 GN=Sorl1 PE=1 SV=1
3	Q92673	0.0	4627	2214	1.000	1.000	SORL_HUMAN Sortilin-related receptor OS=Homo sapiens OX=9606 GN=SORL1 PE=1 SV=2
4	Q95209	0.0	4374	2213	0.942	0.942	SORL_RABIT Sortilin-related receptor OS=Oryctolagus cuniculus OX=9986 GN=SORL1 PE=1 SV=1
5	E0AE56	2.02e-122	436	4673	0.138	0.065	E0AE56_DANRE Low-density lipoprotein receptor-related protein 2 OS=Danio rerio OX=7955 GN=lrp2 PE=1 SV=1
6	Q07954	3.16e-122	436	4544	0.137	0.067	LRP1_HUMAN Prolow-density lipoprotein receptor-related protein 1 OS=Homo sapiens OX=9606 GN=LRP1 PE=1 SV=2
7	Q91ZX7	6.40e-122	435	4545	0.137	0.067	LRP1_MOUSE Prolow-density lipoprotein receptor-related protein 1 OS=Mus musculus OX=10090 GN=Lrp1 PE=1 SV=1
8	G3V928	2.10e-121	433	4545	0.137	0.067	LRP1_RAT Prolow-density lipoprotein receptor-related protein 1 OS=Rattus norvegicus OX=10116 GN=Lrp1 PE=1 SV=1
9	E1BGJ0	2.56e-121	433	4545	0.137	0.067	E1BGJ0_BOVIN LDL receptor related protein 1 OS=Bos taurus OX=9913 GN=LRP1 PE=1 SV=3
10	P98158	2.86e-121	433	4660	0.140	0.066	LRP2_RAT Low-density lipoprotein receptor-related protein 2 OS=Rattus norvegicus OX=10116 GN=Lrp2 PE=1 SV=1
11	A2ARV4	5.29e-120	429	4660	0.135	0.064	LRP2_MOUSE Low-density lipoprotein receptor-related protein 2 OS=Mus musculus OX=10090 GN=Lrp2 PE=1 SV=1
12	Q59FG2	4.68e-119	424	2359	0.137	0.128	Q59FG2_HUMAN Low density lipoprotein-related protein 1 variant (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
13	F1QY34	1.10e-118	424	4549	0.133	0.065	F1QY34_DANRE Low density lipoprotein receptor-related protein 1Ab OS=Danio rerio OX=7955 GN=lrp1ab PE=1 SV=1
14	C0HL13	3.69e-118	423	4652	0.129	0.061	LRP2_PIG Low-density lipoprotein receptor-related protein 2 OS=Sus scrofa OX=9823 GN=LRP2 PE=1 SV=1
15	Q4ZG84	5.03e-112	403	3881	0.135	0.077	Q4ZG84_HUMAN Uncharacterized protein LRP2 (Fragment) OS=Homo sapiens OX=9606 GN=LRP2 PE=3 SV=1
16	Q7Z5C0	8.03e-112	402	4655	0.135	0.064	Q7Z5C0_HUMAN Glycoprotein receptor gp330/megalin OS=Homo sapiens OX=9606 PE=2 SV=1
17	Q7Z5C1	8.10e-112	402	4655	0.135	0.064	Q7Z5C1_HUMAN Glycoprotein receptor gp330/megalin OS=Homo sapiens OX=9606 PE=2 SV=1
18	P98164	8.38e-112	402	4655	0.135	0.064	LRP2_HUMAN Low-density lipoprotein receptor-related protein 2 OS=Homo sapiens OX=9606 GN=LRP2 PE=1 SV=3
19	Q9JI18	6.58e-108	390	4599	0.128	0.062	LRP1B_MOUSE Low-density lipoprotein receptor-related protein 1B OS=Mus musculus OX=10090 GN=Lrp1b PE=1 SV=1
20	A0A8I6AQY2	1.37e-107	389	4469	0.127	0.063	A0A8I6AQY2_RAT LDL receptor related protein 1B OS=Rattus norvegicus OX=10116 GN=Lrp1b PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02012 BNR	24	16.2	BNR/Asp-box repeat
2	PF15899 BNR_6	47	15.5	BNR-Asp box repeat
3	PF00041 fn3	1.3e-33	126.5	Fibronectin type III domain
4	PF16893 fn3_2	8.8	17.9	Fibronectin type III domain
5	PF09294 Interfer-bind	0.0036	28.9	Interferon-alpha/beta receptor, fibronectin type III
6	PF00057 Ldl_recept_a	1.2e-107	363.1	Low-density lipoprotein receptor domain class A
7	PF00058 Ldl_recept_b	1.3e-21	88.1	Low-density lipoprotein receptor repeat class B
8	PF16656 Pur_ac_phosph_N	2.9e-07	42.4	Purple acid Phosphatase, N-terminal domain
9	PF15902 Sortilin-Vps10	2.8e-106	367.6	Sortilin, neurotensin receptor 3,
10	PF15901 Sortilin_C	2e-37	140.6	Sortilin, neurotensin receptor 3, C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260197

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000284981	0.999	Amyloid-beta A4 protein
2	9606.ENSP00000252486	0.995	Apolipoprotein E
3	9606.ENSP00000341344	0.995	ADP-ribosylation factor-binding protein GGA1
4	9606.ENSP00000362480	0.993	Vacuolar protein sorting-associated protein 26A
5	9606.ENSP00000299138	0.964	Vacuolar protein sorting-associated protein 35
6	9606.ENSP00000316454	0.947	Phosphofurin acidic cluster sorting protein 1
7	9606.ENSP00000318585	0.930	Beta-secretase 1
8	9606.ENSP00000421922	0.912	Alpha-2-macroglobulin receptor-associated protein
9	9606.ENSP00000357836	0.905	Sorting nexin-27
10	9606.ENSP00000377015	0.851	Phosphatidylinositol-binding clathrin assembly protein
11	9606.ENSP00000347591	0.829	GDNF family receptor alpha-1
12	9606.ENSP00000263094	0.807	ATP-binding cassette sub-family A member 7
13	9606.ENSP00000409007	0.804	Glial cell line-derived neurotrophic factor
14	9606.ENSP00000311962	0.803	ADP-ribosylation factor-binding protein GGA2
15	9606.ENSP00000445002	0.784	Apolipoprotein A-V
16	9606.ENSP00000480853	0.778	Vacuolar protein sorting-associated protein 29
17	9606.ENSP00000316779	0.771	Myc box-dependent-interacting protein 1
18	9606.ENSP00000453153	0.764	BH3-like motif-containing cell death inducer
19	9606.ENSP00000199447	0.735	Thioredoxin domain-containing protein 3
20	9606.ENSP00000326366	0.735	Presenilin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019899	0.616	enzyme binding
GO:0044877	0.463	protein-containing complex binding
GO:0004888	0.385	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0019222	0.927	regulation of metabolic process
GO:0051179	0.901	localization
GO:0048518	0.880	positive regulation of biological process
GO:0030334	0.867	regulation of cell migration
GO:0051234	0.848	establishment of localization
GO:0071704	0.843	organic substance metabolic process
GO:0060255	0.843	regulation of macromolecule metabolic process
GO:0048519	0.840	negative regulation of biological process
GO:0080090	0.831	regulation of primary metabolic process
GO:0051171	0.828	regulation of nitrogen compound metabolic process
GO:0006810	0.819	transport
GO:0050896	0.811	response to stimulus
GO:0014910	0.804	regulation of smooth muscle cell migration
GO:0051246	0.776	regulation of protein metabolic process
GO:0065009	0.774	regulation of molecular function
GO:0046907	0.766	intracellular transport
GO:0048583	0.763	regulation of response to stimulus
GO:0044237	0.758	cellular metabolic process
GO:0048522	0.758	positive regulation of cellular process
GO:0023051	0.750	regulation of signaling
GO:0010646	0.750	regulation of cell communication
GO:1902991	0.750	regulation of amyloid precursor protein catabolic process
GO:0009966	0.740	regulation of signal transduction
GO:0050790	0.716	regulation of catalytic activity
GO:0043170	0.682	macromolecule metabolic process
GO:0032501	0.664	multicellular organismal process
GO:0048523	0.661	negative regulation of cellular process
GO:0009893	0.649	positive regulation of metabolic process
GO:0031323	0.646	regulation of cellular metabolic process
GO:0010604	0.636	positive regulation of macromolecule metabolic process
GO:0016192	0.614	vesicle-mediated transport
GO:0043086	0.581	negative regulation of catalytic activity
GO:0033036	0.559	macromolecule localization
GO:0048584	0.556	positive regulation of response to stimulus
GO:0008283	0.555	cell population proliferation
GO:0044238	0.542	primary metabolic process
GO:1900076	0.539	regulation of cellular response to insulin stimulus
GO:0046626	0.538	regulation of insulin receptor signaling pathway
GO:0048870	0.513	cell motility
GO:0010605	0.499	negative regulation of macromolecule metabolic process
GO:1900078	0.494	positive regulation of cellular response to insulin stimulus
GO:0044093	0.492	positive regulation of molecular function
GO:0051239	0.480	regulation of multicellular organismal process
GO:0030162	0.473	regulation of proteolysis
GO:0051336	0.472	regulation of hydrolase activity
GO:0032879	0.464	regulation of localization
GO:0008104	0.464	protein localization
GO:0009967	0.448	positive regulation of signal transduction
GO:0051716	0.429	cellular response to stimulus
GO:0043112	0.415	receptor metabolic process
GO:0071702	0.398	organic substance transport
GO:0051172	0.393	negative regulation of nitrogen compound metabolic process
GO:0043085	0.387	positive regulation of catalytic activity
GO:0052548	0.379	regulation of endopeptidase activity
GO:0010941	0.377	regulation of cell death
GO:0006807	0.376	nitrogen compound metabolic process
GO:0046628	0.372	positive regulation of insulin receptor signaling pathway
GO:0033365	0.371	protein localization to organelle
GO:0045184	0.360	establishment of protein localization
GO:0051128	0.355	regulation of cellular component organization
GO:0007034	0.353	vacuolar transport
GO:0034067	0.352	protein localization to Golgi apparatus
GO:0015031	0.350	protein transport
GO:0051248	0.344	negative regulation of protein metabolic process
GO:0010468	0.333	regulation of gene expression
GO:0009894	0.332	regulation of catabolic process
GO:0050793	0.331	regulation of developmental process
GO:0071840	0.327	cellular component organization or biogenesis
GO:0016043	0.320	cellular component organization
GO:0051173	0.314	positive regulation of nitrogen compound metabolic process
GO:1902003	0.312	regulation of amyloid-beta formation
GO:0051049	0.310	regulation of transport
GO:0032502	0.304	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0012505	0.999	endomembrane system
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0031982	0.996	vesicle
GO:0070013	0.996	intracellular organelle lumen
GO:0005768	0.992	endosome
GO:0005634	0.989	nucleus
GO:0005615	0.986	extracellular space
GO:0005886	0.975	plasma membrane
GO:0031090	0.882	organelle membrane
GO:0031975	0.871	envelope
GO:0065010	0.808	extracellular membrane-bounded organelle
GO:0070062	0.789	extracellular exosome
GO:0031967	0.779	organelle envelope
GO:0031981	0.750	nuclear lumen
GO:0012506	0.685	vesicle membrane
GO:0030659	0.676	cytoplasmic vesicle membrane
GO:0005770	0.639	late endosome
GO:0005794	0.617	Golgi apparatus
GO:0098588	0.566	bounding membrane of organelle
GO:0005769	0.566	early endosome
GO:0005635	0.550	nuclear envelope
GO:0005771	0.472	multivesicular body
GO:0005641	0.460	nuclear envelope lumen
GO:0010008	0.419	endosome membrane
GO:0005829	0.413	cytosol
GO:0097356	0.374	perinucleolar compartment
GO:0005654	0.331	nucleoplasm
GO:0036477	0.307	somatodendritic compartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]